Align phosphoribosylanthranilate isomerase; EC 5.3.1.24 (characterized)
to candidate WP_041098007.1 SUTH_RS06465 phosphoribosylanthranilate isomerase
Query= CharProtDB::CH_021917 (235 letters) >NCBI__GCF_000828635.1:WP_041098007.1 Length = 214 Score = 205 bits (522), Expect = 5e-58 Identities = 112/217 (51%), Positives = 143/217 (65%), Gaps = 12/217 (5%) Query: 21 RTRIKLCGLSRPDDVLHAAALGADAIGLVFYAKSPRAVTIAQAAELARLAPPFVSVVGLF 80 RTRIK+CG++R +D+ A A GADA+G VFYA SPR VTI +AA+L P FV+ VGLF Sbjct: 3 RTRIKICGITREEDLAAAVAAGADALGFVFYAPSPRYVTIERAAQLMAQVPAFVTKVGLF 62 Query: 81 VNATAAEIEAVVRDVPLTLLQFHGDETPEQCDALGRAARLPWVRAVRVGPSTQSADLVES 140 VNA + + VPL LLQFHGDE C A GR PW++A RV P DL+E Sbjct: 63 VNAEPQAVRETMAQVPLDLLQFHGDEDAAYCAAFGR----PWIKAARVRP---GFDLLEY 115 Query: 141 SLHYSKA---RGLLFDTLVPDYGGSGKVFDWSLIPAELARRAVLSGGLNAQNVGDAIRQL 197 + ++KA GLL D V YGG GK FDW+LIP L+ +LSGGL+ NV +A+R + Sbjct: 116 ASLFAKAPGVSGLLLDAHVEGYGGGGKTFDWTLIPRNLSLPVILSGGLHPGNVAEAVRTV 175 Query: 198 RPFAVDVSSGIEVEGAKGVKDHARMAAFVRAVRDADA 234 RP+AVDVSSG VE A+G+KD ++ F+ VR+ADA Sbjct: 176 RPWAVDVSSG--VEAARGIKDAQKIIEFIAGVREADA 210 Lambda K H 0.319 0.134 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 142 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 235 Length of database: 214 Length adjustment: 22 Effective length of query: 213 Effective length of database: 192 Effective search space: 40896 Effective search space used: 40896 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory