Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate WP_057508176.1 ABB28_RS08260 nucleoside triphosphate pyrophosphohydrolase
Query= metacyc::MONOMER-21148 (267 letters) >NCBI__GCF_001431535.1:WP_057508176.1 Length = 273 Score = 183 bits (465), Expect = 3e-51 Identities = 108/272 (39%), Positives = 153/272 (56%), Gaps = 8/272 (2%) Query: 2 TKDNAS-LARLTDVIDRLLAPEG-CPWDKEQTPESLCDYLVEECFELVEAIRSGNADEVR 59 T D A+ L RL ++ RL P+G CPWD EQ S+ Y +EE +E+ +AI G+ D++ Sbjct: 3 TSDAATELGRLLAIMARLRDPQGGCPWDLEQDFSSIAPYTIEEAYEVADAIDRGDLDDLC 62 Query: 60 EEMGDVMFLLAFLGRLYADKGAFTLDDAMANNAAKMIRRHPHVFSDTTYADRDEFLRNWE 119 +E+GD++ + F ++ ++GAF D + KM+RRHPH+F+D + D E LRNW+ Sbjct: 63 DELGDLLLQVVFHAQMAQEQGAFAFADVARSINDKMVRRHPHIFADASAGDAAEVLRNWD 122 Query: 120 SIKRAEKADAEGEPQ-GVYDSLPASLPPLLKAYRIHSKAARVGFTWPEDEDVERQVEAEW 178 +IKR E+A A+GE + LP +A ++ S+AA+VGF WP V + E Sbjct: 123 AIKREERA-AKGETDASALAGISRGLPEWQRAMKLQSRAAKVGFDWPGPLPVLDKAAEEL 181 Query: 179 LELLDVLAGDD----KAAQENELGDLIFSLVELGRRKGIKANTALDMTNLKFLRRFRRME 234 EL + D KA + ELGDL+F L R + AL N KF RRFR ME Sbjct: 182 QELREEFERGDVAANKARLQEELGDLLFVCANLARHAELDLGAALRGANHKFERRFRAME 241 Query: 235 ALARERGLDFPALSLDDKDELWNEAKAAEAAA 266 A A E G L LD ++ LW AKAAE+A+ Sbjct: 242 ARAGEHGTRLAELDLDAQEALWQHAKAAESAS 273 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 273 Length adjustment: 25 Effective length of query: 242 Effective length of database: 248 Effective search space: 60016 Effective search space used: 60016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory