Align Acetolactate synthase isozyme II small subunit (characterized, see rationale)
to candidate WP_057509299.1 ABB28_RS14480 ACT domain-containing protein
Query= uniprot:A0A0H2X4P1 (85 letters) >NCBI__GCF_001431535.1:WP_057509299.1 Length = 83 Score = 117 bits (292), Expect = 3e-32 Identities = 58/83 (69%), Positives = 64/83 (77%) Query: 1 MRYRLDLVLKPAEGALVRVIGMTERRGFRPCAIQGAAAPDDAGRWHLQLDVDSTRPPETL 60 M+YRLDLVL PAEGAL+RVIGM ERRGF P AI GA DD GRWHLQL VD +RPPETL Sbjct: 1 MQYRLDLVLHPAEGALLRVIGMAERRGFAPRAINGAPDADDHGRWHLQLVVDGSRPPETL 60 Query: 61 RLQLEKVYDCESVAITALDSVEA 83 Q+EK+YDC SV +T L V A Sbjct: 61 CRQIEKIYDCVSVQVTELQGVAA 83 Lambda K H 0.321 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 52 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 85 Length of database: 83 Length adjustment: 8 Effective length of query: 77 Effective length of database: 75 Effective search space: 5775 Effective search space used: 5775 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 38 (20.5 bits) S2: 38 (19.2 bits)
This GapMind analysis is from Jul 25 2024. The underlying query database was built on Jul 25 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory