Align cystathionine gamma-lyase (EC 4.4.1.1) (characterized)
to candidate WP_057508709.1 ABB28_RS11200 O-succinylhomoserine (thiol)-lyase
Query= BRENDA::Q5H4T8 (397 letters) >NCBI__GCF_001431535.1:WP_057508709.1 Length = 412 Score = 324 bits (830), Expect = 3e-93 Identities = 184/396 (46%), Positives = 244/396 (61%), Gaps = 12/396 (3%) Query: 6 THSHDGDRALSLATLAIHGGQSPDPSTGAVMPPIYATSTYAQSSPGEHQGFEYSRTHNPT 65 +H + G + S T A+ G D + GAV PPI +S ++ G + ++Y+R+ NPT Sbjct: 2 SHDNHGTPSCSRTTAAVRAGIDRDSAYGAVTPPIVLSSNFSFDGFGNKRQYDYTRSGNPT 61 Query: 66 RFAYERCVAALEGGTRAFAFASGMAATSTVME-LLDAGSHVVAMDDLYGGTFRLFERVRR 124 R +A LEGG A+GM A S V++ LL +V D YGG++RLF + Sbjct: 62 RDLLGEALAELEGGAGGVVTATGMGAISLVLQALLGPEDTLVVPHDAYGGSWRLFNALAG 121 Query: 125 RTAGLDFSFV--DLTDPAAFKAAIRADTKMVWIETPTNPMLKLVDIAAIAVIARKHGLLT 182 + F V DLTDP + A+ K+V +ETP+NP+L++ D+ + A K G L Sbjct: 122 KG---QFKLVTADLTDPRSLAQALAGSPKLVLVETPSNPLLRITDLRFVIDAAHKAGALV 178 Query: 183 VVDNTFASPMLQRPLSLGADLVVHSATKYLNGHSDMVGGIAVVGDNAELAEQMAFLQNSI 242 VVDNTF SP LQ+PL+ GADLV+HS TKY+NGHSD+VGG AVV + ELA+Q+ + N++ Sbjct: 179 VVDNTFLSPALQQPLAFGADLVLHSTTKYINGHSDVVGG-AVVARDPELAQQLTWWANAL 237 Query: 243 GGVQGPFDSFLALRGLKTLPLRMRAHCENALALAQWLETHPAIEKVIYPGLASHPQHVLA 302 G PFD+FL LRGL+TL R+R H EN A+ L H A+ V YPGLA HP H +A Sbjct: 238 GLTGSPFDAFLTLRGLRTLDARLRVHQENTAAIVPLLAAHRAVSAVYYPGLADHPGHAIA 297 Query: 303 KRQMSGFGGIVS--IVLKGGFD---AAKRFCEKTELFTLAESLGGVESLVNHPAVMTHAS 357 RQ SGFG ++S +V G D A + F + + FTLAESLGGVESLV HPA MTHA+ Sbjct: 298 ARQQSGFGAMLSFELVTCDGDDPHAAVRAFVDGLQYFTLAESLGGVESLVAHPATMTHAA 357 Query: 358 IPVARREQLGISDALVRLSVGIEDLGDLRGDLERAL 393 + V R+ GIS+ L+RLSVGIE DL DL AL Sbjct: 358 MTVQARQAAGISEGLLRLSVGIESERDLLADLAAAL 393 Lambda K H 0.320 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 23 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 397 Length of database: 412 Length adjustment: 31 Effective length of query: 366 Effective length of database: 381 Effective search space: 139446 Effective search space used: 139446 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory