Align Anthranilate synthase component 1 2; EC 4.1.3.27; Anthranilate synthase component I 2 (uncharacterized)
to candidate WP_057506948.1 ABB28_RS01595 aminodeoxychorismate synthase component I
Query= curated2:Q9HS66 (488 letters) >NCBI__GCF_001431535.1:WP_057506948.1 Length = 454 Score = 229 bits (584), Expect = 2e-64 Identities = 162/391 (41%), Positives = 203/391 (51%), Gaps = 38/391 (9%) Query: 96 VGCDVPHPGGLFGWLSYDIARELEAIPDTTTDARGLPRLQLGVYPTIAAWREPFTPGDDL 155 +G +P GG L Y++A ++E + A G PT A R P Sbjct: 91 LGPTLPFRGGWALLLDYEVASQIETVLPPMARADG--------QPTALALRCP------- 135 Query: 156 RLIAAVPVDEYTPDGAF--EAGRDRV-QSLAAAIRDGDPAVG-----PPPADSPAPFESV 207 AAV D EAG+ + +L A + G PA G P + AP Sbjct: 136 ---AAVLHDHLEQRSYLVAEAGQQALLATLQAQLAAGVPAAGQGWQPPVSVEEDAP---- 188 Query: 208 AGRAAFESRVRRIQDAIRDGDTFQANVSHRLDA--PAAVHPVAVFEALRDTNPAPYSGIV 265 A F VRR+ D + GD FQ N+S R A AV P A++ LR NPAP++G+ Sbjct: 189 ---ARFTDGVRRVIDYLLAGDVFQVNLSRRWCARFADAVSPQALYAQLRRANPAPFAGLF 245 Query: 266 EFPGVDLVSASPELLLARRGRELTTEPIAGTRPRGATPAEDDAARAA-LRADDKERAEHA 324 G +VS+SPE L++ G T PIAGTRPR +DDAAR L KERAEH Sbjct: 246 TGHGRHVVSSSPERLVSVHGGHAQTRPIAGTRPR--FDGDDDAARIQELVGHPKERAEHV 303 Query: 325 MLVDLERNDLGKVSEYGSVAVPDYRRVDAYSEVLHLVSEVTGRLRDSCSLRDAIAAVFPG 384 ML+DLERNDLG++ GSV V + V++Y+ V H+VS V+G LRD + IAA FPG Sbjct: 304 MLIDLERNDLGRICTPGSVVVDELMTVESYAHVHHIVSNVSGTLRDDVTPGQVIAATFPG 363 Query: 385 GTITGAPKPRTMALIDTVEATRRGPYTGSLAAIGFDGDATLSITIRTLVRRAATYHLRVG 444 GTITG PK R M +I +E RG YTG+ + DGD L+I IRT R G Sbjct: 364 GTITGCPKVRCMQIISELEQVPRGAYTGAFGWLNRDGDLDLNILIRTAEVAGNEVSFRTG 423 Query: 445 AGIVHDSTPAAEYDETLAKARALVTALGDAG 475 AGIV DS P E DET AKAR L+ ALG G Sbjct: 424 AGIVVDSDPDKELDETRAKARGLMRALGQQG 454 Lambda K H 0.317 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 579 Number of extensions: 27 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 488 Length of database: 454 Length adjustment: 33 Effective length of query: 455 Effective length of database: 421 Effective search space: 191555 Effective search space used: 191555 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory