Align Glutamyl-tRNA(Gln) amidotransferase subunit A; Glu-ADT subunit A; EC 6.3.5.7 (uncharacterized)
to candidate WP_086510522.1 BZY95_RS13945 amidase
Query= curated2:C1F857 (476 letters) >NCBI__GCF_002151265.1:WP_086510522.1 Length = 449 Score = 126 bits (317), Expect = 1e-33 Identities = 79/212 (37%), Positives = 105/212 (49%), Gaps = 6/212 (2%) Query: 10 IRAVRTGEVRAEAALQECLGAIDAHNGEVNAYLSLDRDGAGARARHIDALSREERAKLPM 69 + R+G ++ C+ AI+ V A+ D + A +A E R P+ Sbjct: 16 VEEFRSGSRTPREYVESCIEAIEGREPIVKAFTCHDIEQARKQADASTRRYAEGRPLSPI 75 Query: 70 GGVPFGIKDVLTVEGMPATASSKILEGYRPPYTATAVQRLIDAGAVLVGKLNCDEFAMGS 129 G+P GIKD++ MP +S I + P A V+ + GA +GK EFA+G Sbjct: 76 DGMPIGIKDIIDTRDMPTERNSDIFSAHYPMTEAACVRAIKQGGAFPLGKTVTTEFAIGR 135 Query: 130 SNENSAYGPVKNPRALDRVPGGSSGGSAAAVAANMAVATLGTDTGGSIRQPASFCGVVGV 189 S GP NP + PGGSS GSAA VAA M A GT T GSI +PASFCGVVG Sbjct: 136 S------GPTVNPHNPEHTPGGSSSGSAAGVAAGMFPAGFGTQTQGSIIRPASFCGVVGF 189 Query: 190 LPTYGRVSRYGLIAFASSLDRVGPFAHTVRDA 221 PT +S G+ + S D +G A +V DA Sbjct: 190 KPTLNALSLNGVHPLSKSHDHLGTIADSVDDA 221 Lambda K H 0.317 0.134 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 526 Number of extensions: 26 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 476 Length of database: 449 Length adjustment: 33 Effective length of query: 443 Effective length of database: 416 Effective search space: 184288 Effective search space used: 184288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory