Align O-phosphoserine sulfhydrylase monomer (EC 2.5.1.47; EC 2.5.1.65) (characterized)
to candidate WP_086510266.1 BZY95_RS12545 cysteine synthase CysM
Query= metacyc::MONOMER-20568 (299 letters) >NCBI__GCF_002151265.1:WP_086510266.1 Length = 298 Score = 264 bits (675), Expect = 2e-75 Identities = 132/299 (44%), Positives = 194/299 (64%), Gaps = 2/299 (0%) Query: 1 MIYDNILETIGNTPLVRINHLNPNPKVQMYAKLEGFNPTGSVKDRIALKMIEQAEAEGKL 60 M + I + +G+TPLVR+ + + AKLEG NP GSVKDR AL M+EQAEA G + Sbjct: 1 MQFPTIEDVVGHTPLVRLKRITAGRNNTLLAKLEGNNPAGSVKDRPALSMLEQAEARGDI 60 Query: 61 HPGSTIIEATSGNTGIGLAMIGRVKGYNVIIVMSEGVSIERRKMIKAFGAEIILTDKKLG 120 PG T+IEATSGNTGI LAM +KGY ++++M + S ER++ + A+GA +I K+ G Sbjct: 61 TPGDTLIEATSGNTGIALAMAAAIKGYRMVLIMPDSASSERKQAMAAYGARLITVSKEGG 120 Query: 121 TDGAIRKVAELVKENPGKYFNPNQFSNEYNKIAHYKTTAEEIWAQTKGTVTHFVAAVGTS 180 + A +V GK N QF+N N +AHY+ T E+W QT GT+THFV+++GT+ Sbjct: 121 MEEARDLAEAMVSRGEGKPLN--QFANPDNPLAHYRGTGPELWEQTGGTITHFVSSMGTT 178 Query: 181 GTLMGVGKNLREKNPEIKIIEAQPTKGHYIQGLKSMEEAIVPAIYQADKIDEHILIESEE 240 GT+MGV + L+E+NPE++I+ QP G I G++ + +P+I+ A ++D + I E Sbjct: 179 GTIMGVSRYLKERNPEVQIVGLQPEDGASIAGIRRWPKEYLPSIFDATRVDRVLDIGQHE 238 Query: 241 AFAKAREIVAQEGIFIGMSSGAAMLAAQKLAEKIDSGVIVVLFADRGEKYLSTKLFDTE 299 A R + +EGI G+SSG A+ A ++AE++++ VIV + DRG++YLST LF E Sbjct: 239 AEEHMRRLAREEGILAGVSSGGALAGALRVAEEVENAVIVFIVCDRGDRYLSTGLFAPE 297 Lambda K H 0.315 0.133 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 299 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 299 Length of database: 298 Length adjustment: 27 Effective length of query: 272 Effective length of database: 271 Effective search space: 73712 Effective search space used: 73712 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory