Align glutamine synthetase (EC 6.3.1.2) (characterized)
to candidate WP_086509872.1 BZY95_RS10470 glutamine synthetase family protein
Query= BRENDA::O33342 (457 letters) >NCBI__GCF_002151265.1:WP_086509872.1 Length = 458 Score = 204 bits (519), Expect = 5e-57 Identities = 158/443 (35%), Positives = 219/443 (49%), Gaps = 25/443 (5%) Query: 22 DVDTVIVAFTDMQGRLAGKRISGRHFVDDIATRGVECCSYLLAVDVDLNTVP--GYAMAS 79 D+D++ + +D+ G + GKRI R +D + +G+ + + A+D++ +T+ G +A Sbjct: 18 DIDSIDLLISDLNGVMRGKRIP-RENLDKVYHQGINLPASVFALDINGHTIEATGLGLAI 76 Query: 80 WDTGYGDMVMTPDLSTLRLIPWLPG--TALVIADLVWADGSEVAVSPRSILRRQLDRLKA 137 D+ D V P TL PWL G A ++ +V D S PR +L RQL+RL Sbjct: 77 GDS---DRVCRPVTGTLMPTPWLRGGRQAQLLMTMVERDESPFFADPRQVLSRQLERLSE 133 Query: 138 RGLVADVATELEFIVFDQPYRQAWASGYRGLTPASDYNID-------YAILASSRMEPLL 190 RGLV A E+EF + D R+ A G R P S + + Y+I L Sbjct: 134 RGLVPVAAVEMEFYLLD---RERTAEG-RIQPPRSPRSGERATQSQLYSIGELDEYADFL 189 Query: 191 RDIRLGMAGAGLRFEAVKGECNMGQQEIGFRY-DEALVTCDNHAIYKNGAKEIADQHGKS 249 D+R GL + EC GQ EI + D+AL CD+ + K K +A HG Sbjct: 190 DDVRRAAECQGLPLDTTLKECAPGQFEITLGHCDDALKACDSAVLLKRLIKGVALNHGFE 249 Query: 250 LTFMAK-YDEREGNSCHIHVSLRGTDGSAVFADSNG-PHGMSSMFRSFVAGQLATLREFT 307 TFMAK Y GN H+H+SL G VFA NG P G ++ R+ VAG L + Sbjct: 250 ATFMAKPYGLEAGNGTHVHLSLLDDTGRNVFAAENGDPLGSETLHRA-VAGLLELMPACM 308 Query: 308 LCYAPTINSYKRFADSSFAPTALAWGLDNRTCALRV-VGHGQNIRVECRVPGGDVNQYLA 366 AP +NS++RF + P WG DNR+ ALR+ G R+E RV G DVN YL Sbjct: 309 AICAPNLNSFRRFQPGLYVPMTPTWGFDNRSVALRIPSGCNDARRIEHRVAGADVNPYLL 368 Query: 367 VAALIAGGLYGIERGLQLPEPCVGNAYQGADVERLPVTLADAAVLFEDSALVREAFGEDV 426 +A L+AG YGI+R L P P GNAY+ + L + A L E S ++ A G D Sbjct: 369 LAVLLAGIDYGIDRQLTPPAPVEGNAYEQFE-PTLTNSWQQALDLLEASEPLKAALGADF 427 Query: 427 VAHYLNNARVELAAFNAAVTDWE 449 V +L N R E AV+ E Sbjct: 428 VHVFLANRRAEREQAMQAVSQLE 450 Lambda K H 0.321 0.137 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 525 Number of extensions: 27 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 457 Length of database: 458 Length adjustment: 33 Effective length of query: 424 Effective length of database: 425 Effective search space: 180200 Effective search space used: 180200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory