GapMind for Amino acid biosynthesis

 

Alignments for a candidate for hisH in Billgrantia desiderata SP1

Align Imidazole glycerol phosphate synthase subunit HisH; IGP synthase glutaminase subunit; IGP synthase subunit HisH; ImGP synthase subunit HisH; IGPS subunit HisH; EC 4.3.2.10; EC 3.5.1.2 (characterized)
to candidate WP_086509911.1 BZY95_RS10700 cobyric acid synthase

Query= SwissProt::Q7SIC0
         (200 letters)



>NCBI__GCF_002151265.1:WP_086509911.1
          Length = 488

 Score = 44.3 bits (103), Expect = 4e-09
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 41  ADLLVLPGQGHFGQVMRAFQESGFVERVRRHLERGLPFLGICVGMQVLYEGSEEAPGVRG 100
           ADL+VLPG       +   +  G+ E ++RHL  G   LGIC G+Q+L     +  G+ G
Sbjct: 293 ADLIVLPGSKSTRSDLEWLRAQGWEEAIQRHLRYGGRVLGICGGLQMLGRAVHDPEGLEG 352

Query: 101 -LGLVPG 106
             G  PG
Sbjct: 353 PAGSTPG 359


Lambda     K      H
   0.322    0.141    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 278
Number of extensions: 15
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 200
Length of database: 488
Length adjustment: 27
Effective length of query: 173
Effective length of database: 461
Effective search space:    79753
Effective search space used:    79753
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory