Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate WP_086510679.1 BZY95_RS14805 5-dehydro-4-deoxyglucarate dehydratase
Query= metacyc::BSU16770-MONOMER (290 letters) >NCBI__GCF_002151265.1:WP_086510679.1 Length = 305 Score = 110 bits (276), Expect = 3e-29 Identities = 87/285 (30%), Positives = 136/285 (47%), Gaps = 14/285 (4%) Query: 11 ITPFDNKGNVDFQKLSTLIDYLLKNGTDSLVVAGTTGESPTLSTEEKIALFEYTVKEVNG 70 IT FD +G D +++ + + ++ VAG TGE LS +E + V+ V G Sbjct: 21 ITDFDKEGRFDADSYRRRLEWFISHDISAVFVAGGTGEFFNLSLDEYRDVVRVAVETVAG 80 Query: 71 RVPVIAGTGSNNTKDSIKLTKKAEEAGVDAVMLVTPYYNKPSQEGMYQHFKAIAAETSLP 130 R+PVIA +G + K AE AG D ++L+ PY + QEG+ ++ +AI T L Sbjct: 81 RLPVIASSGL-SVASGRAFAKAAEAAGADGILLMPPYLTECPQEGLVEYARAICDSTELN 139 Query: 131 VMLYNVPGRTVASLAPETTIRLAADIPNVVAIKEASGDLEAITKIIAETPEDFYVYSGDD 190 V+ YN R L + LAA PN++ +K+ GD++A+ KII +T D VY G Sbjct: 140 VIYYN---RGNGVLDAGSVRALAASCPNLIGLKDGKGDIQALNKII-KTIGDRLVYVG-G 194 Query: 191 ALTLPILSVG--GRGVVSVASHIAGTDMQQMIKNYTNGQTANAALIHQ----KLLPIMKE 244 T I + GV + +S + +K Y + NA ++ + +P + Sbjct: 195 VPTAEIFAEAYLAIGVNTYSSAVFNFVPDMAVKFYRELRAGNAEVVKRITSDFFIPFVDL 254 Query: 245 LFKAPNPAP--VKTALQLRGLDVGSVRLPLVPLTEDERLSLSSTI 287 + P A +K ++ G GSVR PLV T +ER L + Sbjct: 255 RDRKPGYAVSLIKAGAEIIGRPAGSVRAPLVMPTPEERSRLEKLV 299 Lambda K H 0.313 0.131 0.356 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 196 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 290 Length of database: 305 Length adjustment: 26 Effective length of query: 264 Effective length of database: 279 Effective search space: 73656 Effective search space used: 73656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory