GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argA in Shewanella sp. ANA-3

Align amino-acid acetyltransferase (characterized)
to candidate 7026634 Shewana3_3767 N-acetylglutamate synthase (RefSeq)

Query= CharProtDB::CH_024150
         (443 letters)



>FitnessBrowser__ANA3:7026634
          Length = 445

 Score =  596 bits (1537), Expect = e-175
 Identities = 286/438 (65%), Positives = 357/438 (81%)

Query: 5   RKTELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSIVNDIGLLHSLGIRLVVVYG 64
           R TELV+GFRHS PY+N HRGKTFV+MLGGEA+    F  I+ND+ LLHSLGI++V+VYG
Sbjct: 8   RTTELVDGFRHSAPYVNAHRGKTFVVMLGGEALAQNQFRGILNDVALLHSLGIKVVLVYG 67

Query: 65  ARPQIDANLAAHHHEPLYHKNIRVTDAKTLELVKQAAGTLQLDITARLSMSLNNTPLQGA 124
           ARPQIDA LAA+  EP YH+ +R+TD  +L+++KQ AG LQ DITARLSMSL+NTP+QGA
Sbjct: 68  ARPQIDAALAANGIEPAYHEGVRITDEDSLKVIKQVAGALQFDITARLSMSLSNTPMQGA 127

Query: 125 HINVVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEDAIHRQLDSGAIVLMGPVAVSVTGES 184
            IN+VSGNF+IAQPLGVD+GVD+C SG++RRID   + RQLD+  IVLMGP+A SVTGES
Sbjct: 128 QINLVSGNFVIAQPLGVDNGVDFCLSGKVRRIDTQGLKRQLDNHCIVLMGPIAASVTGES 187

Query: 185 FNLTSEEIATQLAIKLKAEKMIGFCSSQGVTNDDGDIVSELFPNEAQARVEAQEEKGDYN 244
           FNLT+EEIATQ+AIKLKA+KMIGF S  G+ + +GD+++EL PN+AQ  +    E+G   
Sbjct: 188 FNLTAEEIATQVAIKLKADKMIGFSSQNGILDRNGDVIAELMPNDAQNILTKLAEQGSAC 247

Query: 245 SGTVRFLRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRRATIN 304
            GT+ FL+ ++ ACR+GV RCHL+SY +DGALLQELFSR+GIGTQIV ESAE++RRA+I+
Sbjct: 248 VGTMAFLKASIDACRNGVPRCHLVSYLDDGALLQELFSREGIGTQIVTESAERLRRASIS 307

Query: 305 DIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKIGEMA 364
           DIGG+L LIRPLE+QGILVRRSREQLE+EI++F +I+RD   I CAALYPF E+  GE A
Sbjct: 308 DIGGVLNLIRPLEEQGILVRRSREQLEIEIEQFMLIERDGLVIGCAALYPFEEDNAGEFA 367

Query: 365 CVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDLLPES 424
           C+ VHPDYR + RG +LL+ I  QA+  G S+LF LTTRSIHWF E GF   D++ LP+ 
Sbjct: 368 CLVVHPDYRDADRGSLLLKNIIGQARSRGYSRLFALTTRSIHWFLEHGFVIEDVEALPQK 427

Query: 425 KKQLYNYQRKSKVLMADL 442
           KKQLYNYQR+SK+L  DL
Sbjct: 428 KKQLYNYQRRSKILALDL 445


Lambda     K      H
   0.319    0.136    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 611
Number of extensions: 14
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 443
Length of database: 445
Length adjustment: 32
Effective length of query: 411
Effective length of database: 413
Effective search space:   169743
Effective search space used:   169743
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate 7026634 Shewana3_3767 (N-acetylglutamate synthase (RefSeq))
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))

Software error:

../bin/blast/fastacmd -i /tmp/list.9330.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.9330.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.