Align Aspartate--tRNA(Asp/Asn) ligase; EC 6.1.1.23; Aspartyl-tRNA synthetase; AspRS; Non-discriminating aspartyl-tRNA synthetase; ND-AspRS (uncharacterized)
to candidate 7025143 Shewana3_2306 asparaginyl-tRNA synthetase (RefSeq)
Query= curated2:Q8TXG4 (431 letters) >FitnessBrowser__ANA3:7025143 Length = 466 Score = 177 bits (450), Expect = 5e-49 Identities = 141/453 (31%), Positives = 215/453 (47%), Gaps = 54/453 (11%) Query: 16 GEEVRLAGWVHEVRDL-GGIKFVLLRDRTGIVQLTLPKQKVPKETFE----KVPKLTKES 70 G V + GWV RD GI F+ + D + P Q V + E +V KLT Sbjct: 17 GSTVTVRGWVRTRRDSKAGISFLAVYDGSCFN----PIQGVVPNSLENYDNEVLKLTAGC 72 Query: 71 VIRVEGTVQANEKAPGGVEVIPQRIEV---LSESDTHLPLDPTGKVDADLDTRLDARVLD 127 + V G + + A E+ +EV + + DT+ P ++ + L Sbjct: 73 SVIVTGEIVESPGAGQAYELQVTHVEVTGWVEDPDTY----PMAAKRHSIEHLRELAHLR 128 Query: 128 LRREEPQAIFKIRNVVTTAIREFLEERGFIEVHTPKIIASATEGGTELFPVV-------- 179 R A+ ++RN ++ AI F E GF+ V TP I AS EG E+F V Sbjct: 129 PRTNIIGAVARVRNCLSQAIHRFYHENGFVWVSTPLITASDCEGAGEMFRVSTLDMENLP 188 Query: 180 ------------YFERDAYLAQSPQLYKQMLMAAGFERVYEIGPIFRAEEHNTRRHLNEA 227 +F ++A+L S QL + A ++Y GP FRAE NT RHL E Sbjct: 189 RTSDGKVDYDKDFFGKEAFLTVSGQLNGETY-ACALSKIYTFGPTFRAENSNTSRHLAEF 247 Query: 228 ISVDIEMSFIESEEDVMRVLEELLAHVFRKVREECEKELE---------ALDRELPELET 278 V+ E++F + D+ + E +L + F V E +L+ ++R + + Sbjct: 248 WMVEPEVAFA-TLSDIASLAEGMLKYAFNAVLAERMDDLQFFAQHVDKTVIERLQSFVSS 306 Query: 279 PFERITYEETLDLLSEHGIEVE----WGEDLPTEAERKLGEI-FEEPFFITEWPRETRPF 333 F ++ Y + +D+L + G E E WG DL +E ER L E F+ P + +P++ + F Sbjct: 307 DFAQVDYTDAVDILQKCGREFEFPVSWGIDLSSEHERYLAEEHFKAPVVVKNYPKDIKAF 366 Query: 334 YTMAKDDEVTTA-FDLMYQGL-ELASGAQREHRYDVLVRQIEEQGLSPEDFRHYLEAFKY 391 Y +D T A D++ G+ E+ G+QRE R DVL ++EE L+ ED+ Y + +Y Sbjct: 367 YMRLNEDGKTVAAMDVLAPGIGEIIGGSQREERLDVLDMRLEEMDLNKEDYWWYRDLRRY 426 Query: 392 GMPPHGGWGLGLERTLMTITGAENIREVTLFPR 424 G PH G+GLG ER + +TG NIR+V FPR Sbjct: 427 GTVPHSGFGLGFERLVSYVTGVSNIRDVIPFPR 459 Lambda K H 0.318 0.138 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 454 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 431 Length of database: 466 Length adjustment: 33 Effective length of query: 398 Effective length of database: 433 Effective search space: 172334 Effective search space used: 172334 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory