GapMind for Amino acid biosynthesis

 

Aligments for a candidate for aroC in Shewanella sp. ANA-3

Align Chorismate synthase; CS; 5-enolpyruvylshikimate-3-phosphate phospholyase; EPSP phospholyase; EC 4.2.3.5 (characterized)
to candidate 7024277 Shewana3_1469 chorismate synthase (RefSeq)

Query= SwissProt::P12008
         (361 letters)



>lcl|FitnessBrowser__ANA3:7024277 Shewana3_1469 chorismate synthase
           (RefSeq)
          Length = 364

 Score =  563 bits (1452), Expect = e-165
 Identities = 277/359 (77%), Positives = 316/359 (88%)

Query: 1   MAGNTIGQLFRVTTFGESHGLALGCIVDGVPPGIPLTEADLQHDLDRRRPGTSRYTTQRR 60
           M+GN+IGQ F VTTFGESHG+ALGCI+DG PPG+ LTEAD+QHDLDRRRPGTSRYTT RR
Sbjct: 1   MSGNSIGQNFVVTTFGESHGVALGCIIDGCPPGLELTEADMQHDLDRRRPGTSRYTTARR 60

Query: 61  EPDQVKILSGVFEGVTTGTSIGLLIENTDQRSQDYSAIKDVFRPGHADYTYEQKYGLRDY 120
           EPD+V+ILSGVFEG TTGTSIGLLIENTDQRSQDYS IKD+FRPGHADYTY+QKYGLRDY
Sbjct: 61  EPDEVRILSGVFEGKTTGTSIGLLIENTDQRSQDYSNIKDLFRPGHADYTYQQKYGLRDY 120

Query: 121 RGGGRSSARETAMRVAAGAIAKKYLAEKFGIEIRGCLTQMGDIPLDIKDWSQVEQNPFFC 180
           RGGGRSSARETAMRVAAGA+AKKYL +  GI I+G ++Q+G I  +  D+SQ+EQN FF 
Sbjct: 121 RGGGRSSARETAMRVAAGAVAKKYLKQVHGISIQGYMSQLGPISAETLDFSQIEQNAFFF 180

Query: 181 PDPDKIDALDELMRALKKEGDSIGAKVTVVASGVPAGLGEPVFDRLDADIAHALMSINAV 240
           PD  K++ALDE MR LKK GDSIGAK++VVA+GVP GLGEPVFDRLDADIAHALM INAV
Sbjct: 181 PDASKLEALDEYMRELKKSGDSIGAKISVVATGVPVGLGEPVFDRLDADIAHALMGINAV 240

Query: 241 KGVEIGDGFDVVALRGSQNRDEITKDGFQSNHAGGILGGISSGQQIIAHMALKPTSSITV 300
           KGVEIGDGF VV  +GS+ RD ++  GF+SNHAGGILGGISSGQ I+AH+ALKPTSSI+V
Sbjct: 241 KGVEIGDGFGVVTQKGSEGRDLMSPLGFESNHAGGILGGISSGQPIVAHIALKPTSSISV 300

Query: 301 PGRTINRFGEEVEMITKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRQRAQNADVKTDIP 359
           PG+++   GE  E++TKGRHDPCVGIRAVPIAEAMLAIVLMDHLLR RAQN DV++  P
Sbjct: 301 PGQSMTAQGEMAEVVTKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRHRAQNQDVRSHTP 359


Lambda     K      H
   0.319    0.138    0.404 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 485
Number of extensions: 13
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 361
Length of database: 364
Length adjustment: 29
Effective length of query: 332
Effective length of database: 335
Effective search space:   111220
Effective search space used:   111220
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)

Align candidate 7024277 Shewana3_1469 (chorismate synthase (RefSeq))
to HMM TIGR00033 (aroC: chorismate synthase (EC 4.2.3.5))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00033.hmm
# target sequence database:        /tmp/gapView.30381.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00033  [M=351]
Accession:   TIGR00033
Description: aroC: chorismate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   5.1e-143  462.2   0.3   5.8e-143  462.0   0.3    1.0  1  lcl|FitnessBrowser__ANA3:7024277  Shewana3_1469 chorismate synthas


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7024277  Shewana3_1469 chorismate synthase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  462.0   0.3  5.8e-143  5.8e-143       1     350 [.      10     350 ..      10     351 .. 0.97

  Alignments for each domain:
  == domain 1  score: 462.0 bits;  conditional E-value: 5.8e-143
                         TIGR00033   1 lrlttfGeSHgkalgaiidGlPaglelteediqkelkrRrpgqsrltrmrkEeDeveilsGvfeGkTtGaPiallik 77 
                                       + +ttfGeSHg alg+iidG+P+glelte+d+q++l+rRrpg+sr+t+ r+E Dev+ilsGvfeGkTtG+ i lli+
  lcl|FitnessBrowser__ANA3:7024277  10 FVVTTFGESHGVALGCIIDGCPPGLELTEADMQHDLDRRRPGTSRYTTARREPDEVRILSGVFEGKTTGTSIGLLIE 86 
                                       569************************************************************************** PP

                         TIGR00033  78 NkdvrskdyedikelpRPgHadytylkKYgikdregggrsSaReTaarvaaGavakklLketagieivayvvklgev 154
                                       N+d+rs+dy++ik+l+RPgHadyty++KYg++d++gggrsSaReTa+rvaaGavakk+Lk+ +gi i +y+++lg +
  lcl|FitnessBrowser__ANA3:7024277  87 NTDQRSQDYSNIKDLFRPGHADYTYQQKYGLRDYRGGGRSSARETAMRVAAGAVAKKYLKQVHGISIQGYMSQLGPI 163
                                       ***************************************************************************** PP

                         TIGR00033 155 eleeesakeiskerldkspvrcpdaeaekemeeeidkakkdgdsvGgvvevvvsnvpvglGeplfdkldaelasall 231
                                       ++e+  +      +++++ +++pda++ +++ e++ ++kk+gds+G++++vv+++vpvglGep+fd+lda +a+al+
  lcl|FitnessBrowser__ANA3:7024277 164 SAETLDF-----SQIEQNAFFFPDASKLEALDEYMRELKKSGDSIGAKISVVATGVPVGLGEPVFDRLDADIAHALM 235
                                       *996444.....5799************************************************************* PP

                         TIGR00033 232 sinAvKgveiGdGFeaasvrGseanDelvleddkirrktnnsGGieGGitnGedirvriavKpiptikkplktvdle 308
                                       +inAvKgveiGdGF  ++++Gse  D +      + + +n+ GGi+GGi+ G++i+ +ia+Kp+++i+ p ++++ +
  lcl|FitnessBrowser__ANA3:7024277 236 GINAVKGVEIGDGFGVVTQKGSEGRDLM----SPLGFESNHAGGILGGISSGQPIVAHIALKPTSSISVPGQSMTAQ 308
                                       **************************54....5899****************************************9 PP

                         TIGR00033 309 tkekakatkgRhDpcvvpravpvvEamvalvladallekras 350
                                       ++ +  +tkgRhDpcv +ravp++Eam+a+vl+d+ll++ra+
  lcl|FitnessBrowser__ANA3:7024277 309 GEMAEVVTKGRHDPCVGIRAVPIAEAMLAIVLMDHLLRHRAQ 350
                                       99999999*******************************987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (351 nodes)
Target sequences:                          1  (364 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.60
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory