GapMind for Amino acid biosynthesis

 

Aligments for a candidate for aroG in Shewanella sp. ANA-3

Align 3-deoxy-7-phosphoheptulonate synthase, Trp-sensitive (EC 2.5.1.54) (characterized)
to candidate 7024556 Shewana3_1734 phospho-2-dehydro-3-deoxyheptonate aldolase (RefSeq)

Query= ecocyc::AROH-MONOMER
         (348 letters)



>lcl|FitnessBrowser__ANA3:7024556 Shewana3_1734
           phospho-2-dehydro-3-deoxyheptonate aldolase (RefSeq)
          Length = 354

 Score =  450 bits (1157), Expect = e-131
 Identities = 217/341 (63%), Positives = 267/341 (78%)

Query: 3   RTDELRTARIESLVTPAELALRYPVTPGVATHVTDSRRRIEKILNGEDKRLLVIIGPCSI 62
           +TDELRT+ +  +++PA+LA  YP+T   A ++   RR +E I+ GED+RLLVIIGPCSI
Sbjct: 4   KTDELRTSLLAKVISPAQLASEYPLTQDAADYLVQQRREVEAIIMGEDQRLLVIIGPCSI 63

Query: 63  HDLTAAMEYATRLQSLRNQYQSRLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNHGL 122
           HD  AA++YA RL  L  + +  L I+MR YFEKPRT+VGWKGLISDPDL+GS+  N GL
Sbjct: 64  HDTQAALDYARRLAVLHQELKDDLCILMRVYFEKPRTIVGWKGLISDPDLDGSFEPNKGL 123

Query: 123 ELARKLLLQVNELGVPTATEFLDMVTGQFIADLISWGAIGARTTESQIHREMASALSCPV 182
            +AR+LL Q+ EL +P ATEFLDMV GQ+IADLI+WGAIGARTTESQ+HREMASALSCPV
Sbjct: 124 RIARELLQQITELKLPIATEFLDMVNGQYIADLITWGAIGARTTESQVHREMASALSCPV 183

Query: 183 GFKNGTDGNTRIAVDAIRAARASHMFLSPDKNGQMTIYQTSGNPYGHIIMRGGKKPNYHA 242
           GFKNGTDGN  IAVDA+RAA+  H+F SPDK+G M++Y+T GNPYGHII+RGGKKPNY  
Sbjct: 184 GFKNGTDGNINIAVDAVRAAKVPHIFYSPDKDGAMSVYRTHGNPYGHIILRGGKKPNYFE 243

Query: 243 DDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLEVCEDICQQIRNGSTAIAGIMAES 302
            DI  A   L   D+   +VVDFSHGN +K H +QL V ++I  Q+R GSTAIAG+MAES
Sbjct: 244 QDIEEARLKLESVDVTPRMVVDFSHGNSEKNHLKQLVVADNIMAQMRAGSTAIAGVMAES 303

Query: 303 FLREGTQKIVGSQPLTYGQSITDPCLGWEDTERLVEKLASA 343
           FL+EG QK+V  QPL YGQSITD CL W+D+E+L+  LA A
Sbjct: 304 FLQEGNQKVVEGQPLCYGQSITDACLHWDDSEKLLRDLAKA 344


Lambda     K      H
   0.320    0.135    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 400
Number of extensions: 7
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 348
Length of database: 354
Length adjustment: 29
Effective length of query: 319
Effective length of database: 325
Effective search space:   103675
Effective search space used:   103675
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate 7024556 Shewana3_1734 (phospho-2-dehydro-3-deoxyheptonate aldolase (RefSeq))
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00034.hmm
# target sequence database:        /tmp/gapView.30679.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00034  [M=342]
Accession:   TIGR00034
Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   6.5e-162  524.0   0.0   7.5e-162  523.8   0.0    1.0  1  lcl|FitnessBrowser__ANA3:7024556  Shewana3_1734 phospho-2-dehydro-


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7024556  Shewana3_1734 phospho-2-dehydro-3-deoxyheptonate aldolase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  523.8   0.0  7.5e-162  7.5e-162       1     342 []       6     349 ..       6     349 .. 0.99

  Alignments for each domain:
  == domain 1  score: 523.8 bits;  conditional E-value: 7.5e-162
                         TIGR00034   1 ddlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakrlkklaek 77 
                                       d+lr+  + ++++P++l++++plt++aa+ + ++r+e++ i+ G+d+rllv+iGPcsihd +aal+ya+rl+ l ++
  lcl|FitnessBrowser__ANA3:7024556   6 DELRTSLLAKVISPAQLASEYPLTQDAADYLVQQRREVEAIIMGEDQRLLVIIGPCSIHDTQAALDYARRLAVLHQE 82 
                                       68999999********************************************************************* PP

                         TIGR00034  78 lkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatelldtispqyladllsw 154
                                       lkddl i+mrvyfekPrt+vGWkGli+dPdl++sf+ nkGlriar+ll +++el lp+ate+ld++ +qy+adl++w
  lcl|FitnessBrowser__ANA3:7024556  83 LKDDLCILMRVYFEKPRTIVGWKGLISDPDLDGSFEPNKGLRIARELLQQITELKLPIATEFLDMVNGQYIADLITW 159
                                       ***************************************************************************** PP

                         TIGR00034 155 gaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvtkaGqvaivetkGnedghiilrGG 231
                                       gaiGarttesqvhre+as+ls+pvgfkngtdG++++a+da+raa+ +h+f s++k+G++++++t+Gn++ghiilrGG
  lcl|FitnessBrowser__ANA3:7024556 160 GAIGARTTESQVHREMASALSCPVGFKNGTDGNINIAVDAVRAAKVPHIFYSPDKDGAMSVYRTHGNPYGHIILRGG 236
                                       ***************************************************************************** PP

                         TIGR00034 232 kkpnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlevaesvveqiaeGekaiiGvmiesnleeGnqsl. 307
                                       kkpny ++d++e++ +le ++ ++++++dfshgns+k++ +ql va+++++q++ G++ai+Gvm es+l+eGnq++ 
  lcl|FitnessBrowser__ANA3:7024556 237 KKPNYFEQDIEEARLKLESVDVTPRMVVDFSHGNSEKNHLKQLVVADNIMAQMRAGSTAIAGVMAESFLQEGNQKVv 313
                                       ***************************************************************************98 PP

                         TIGR00034 308 .keelkyGksvtdacigwedteallrklaeavkerr 342
                                        +++l yG+s+tdac++w+d+e+llr+la+a ++rr
  lcl|FitnessBrowser__ANA3:7024556 314 eGQPLCYGQSITDACLHWDDSEKLLRDLAKASRDRR 349
                                       8899***************************99885 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (342 nodes)
Target sequences:                          1  (354 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 8.33
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory