GapMind for Amino acid biosynthesis

 

Aligments for a candidate for asp-kinase in Shewanella sp. ANA-3

Align aspartate kinase (EC 2.7.2.4) (characterized)
to candidate 7023422 Shewana3_0652 aspartate kinase III (RefSeq)

Query= BRENDA::P08660
         (449 letters)



>lcl|FitnessBrowser__ANA3:7023422 Shewana3_0652 aspartate kinase III
           (RefSeq)
          Length = 451

 Score =  517 bits (1331), Expect = e-151
 Identities = 272/447 (60%), Positives = 339/447 (75%), Gaps = 1/447 (0%)

Query: 4   IVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALA-EGLEPGERFE 62
           +VV+KFGGTSVAD+ AMNR ADIVL + + RLVV+SAS+G+TNLLV L  E +    R +
Sbjct: 3   LVVAKFGGTSVADYGAMNRCADIVLGNPDCRLVVVSASSGVTNLLVELTQESMNDDGRLQ 62

Query: 63  KLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGELMS 122
           +L  I  IQ+AIL++L  PN +   +++LL  + VL+EA A   S A  DEL+S GE  S
Sbjct: 63  RLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMAVLSEALASQRSKATMDELLSLGEQCS 122

Query: 123 TLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIAALAELAALQLLPRLNEGLVITQ 182
           + LF  +LRE+   +  FDVR+V+RT+  FGRAEP +  +A L+   LLP L+E +++TQ
Sbjct: 123 SALFAAVLREKGANSSAFDVRRVLRTDSHFGRAEPQVEQIAILSREHLLPLLSEQVIVTQ 182

Query: 183 GFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRIDE 242
           GFIGS+  G+TTTLGRGGSDY+AALLAEAL AS V+IWTDV GIYTTDPR+   A  I E
Sbjct: 183 GFIGSDEAGQTTTLGRGGSDYSAALLAEALKASAVEIWTDVAGIYTTDPRLAPNAHPIAE 242

Query: 243 IAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFRAL 302
           I+F EAAEMATFGAKVLHPAT+LPAVR  I VFVGSSK+P  GGT + ++ E+ P+FRA+
Sbjct: 243 ISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFRAV 302

Query: 303 ALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTSTG 362
           ALRR+QTLL LHSL MLH++GFLAE F  LARH ISVDLITTSEV+V+LTLD TGS S+G
Sbjct: 303 ALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDSSG 362

Query: 363 DTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICYGA 422
             LL+++LL ELS  CRV VE+GLALVA+IGN ++   G+ + VF VLEP N+RMIC GA
Sbjct: 363 QGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTAGICRRVFEVLEPHNVRMICQGA 422

Query: 423 SSHNLCFLVPGEDAEQVVQKLHSNLFE 449
           S HNLC LV   +A QVV+ LH NLFE
Sbjct: 423 SPHNLCVLVAESEAAQVVKALHENLFE 449


Lambda     K      H
   0.320    0.135    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 506
Number of extensions: 9
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 449
Length of database: 451
Length adjustment: 33
Effective length of query: 416
Effective length of database: 418
Effective search space:   173888
Effective search space used:   173888
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate 7023422 Shewana3_0652 (aspartate kinase III (RefSeq))
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00656.hmm
# target sequence database:        /tmp/gapView.13429.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00656  [M=407]
Accession:   TIGR00656
Description: asp_kin_monofn: aspartate kinase, monofunctional class
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   2.8e-135  437.4   0.8   3.2e-135  437.2   0.8    1.0  1  lcl|FitnessBrowser__ANA3:7023422  Shewana3_0652 aspartate kinase I


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7023422  Shewana3_0652 aspartate kinase III (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  437.2   0.8  3.2e-135  3.2e-135       1     406 [.       1     449 [.       1     450 [. 0.93

  Alignments for each domain:
  == domain 1  score: 437.2 bits;  conditional E-value: 3.2e-135
                         TIGR00656   1 veliVqKFGGtsvgsserikkaakivlkelkegkkvvVVvSAmskvtdelvelae...................... 55 
                                       ++l+V+KFGGtsv++  ++++ a+ivl +    + ++VVvSA+s+vt+ lvel++                      
  lcl|FitnessBrowser__ANA3:7023422   1 MSLVVAKFGGTSVADYGAMNRCADIVLGN---PDCRLVVVSASSGVTNLLVELTQesmnddgrlqrlkqiaqiqyai 74 
                                       679*************************9...899*******************99999999999887744444443 PP

                         TIGR00656  56 ..llklleaisdei............................sprerdelvsvGEllssallssalrelgvkaeald 102
                                                                                 s++++del+s+GE+ ssal++ +lre+g ++ a+d
  lcl|FitnessBrowser__ANA3:7023422  75 ldK----------LgrpndvaaaldkllsrmavlsealasqrSKATMDELLSLGEQCSSALFAAVLREKGANSSAFD 141
                                       330..........34444444445555555555555555555*********************************** PP

                         TIGR00656 103 gkeagilTddefgnAkikelate....erLlelLeegiivvvaGFiGateeGeiTtLGRGGSDltAallaaalkAdr 175
                                        ++ +++Td++fg+A+++ ++++    e+Ll+lL e+ ++v++GFiG++e G++TtLGRGGSD++Aalla+alkA+ 
  lcl|FitnessBrowser__ANA3:7023422 142 -VRRVLRTDSHFGRAEPQVEQIAilsrEHLLPLLSEQ-VIVTQGFIGSDEAGQTTTLGRGGSDYSAALLAEALKASA 216
                                       .999***************99999999*********9.889************************************ PP

                         TIGR00656 176 veiyTDVeGvyttDPrvveeakkidkisyeEalelAtlGakvlhpralelaveakvpilvrsskeke.egTlitnkk 251
                                       vei+TDV G+yttDPr+ ++a++i++is++Ea+e+At+Gakvlhp+++ +av+++++++v sske+e  gT i ++ 
  lcl|FitnessBrowser__ANA3:7023422 217 VEIWTDVAGIYTTDPRLAPNAHPIAEISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEkGGTWIRHQV 293
                                       *******************************************************************999******* PP

                         TIGR00656 252 ensslvkaialeknvarltvegegmlgkrgilaeifkaLaeeeinvdlisqtesetsislvvdeedvdeakkaLkee 328
                                       e  ++++a+al++++++l++++ +ml+ +g+lae f +La+++i+vdli+++e  +++sl++d++++d++ + L +e
  lcl|FitnessBrowser__ANA3:7023422 294 EDAPVFRAVALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSE--VNVSLTLDKTGSDSSGQGLLSE 368
                                       **************************************************999..********************99 PP

                         TIGR00656 329 sgaae...lesleveedlavvsivgaglveapGvaseifkaleekninilmisssetkisvlvdekdaekavrklhe 402
                                        +++e    +++ ve +la+v+i+g+ +  + G+  ++f++le++n+++++ ++s ++++vlv e +a ++v++lhe
  lcl|FitnessBrowser__ANA3:7023422 369 ALLQElsqHCRVRVEDGLALVAIIGNRIATTAGICRRVFEVLEPHNVRMICQGASPHNLCVLVAESEAAQVVKALHE 445
                                       9888877789******************************************************************* PP

                         TIGR00656 403 klee 406
                                       +l+e
  lcl|FitnessBrowser__ANA3:7023422 446 NLFE 449
                                       *986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (407 nodes)
Target sequences:                          1  (451 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.02
# Mc/sec: 6.59
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory