Align Cysteine synthase B; CSase B; O-acetylserine (thiol)-lyase B; OAS-TL B; O-acetylserine sulfhydrylase B; EC 2.5.1.47 (characterized)
to candidate 7026046 Shewana3_3188 cysteine synthase B (RefSeq)
Query= SwissProt::P16703 (303 letters) >FitnessBrowser__ANA3:7026046 Length = 292 Score = 384 bits (986), Expect = e-111 Identities = 197/291 (67%), Positives = 238/291 (81%), Gaps = 6/291 (2%) Query: 3 TLEQTIGNTPLVKLQRMGPDNGSE-VWLKLEGNNPAGSVKDRAALSMIVEAEKRGEIKPG 61 T+E IG TPLV+LQR+ D GS V LKLEGNNPAGSVKDRAAL+MI++AE R EI PG Sbjct: 6 TIEACIGQTPLVRLQRL--DCGSSTVLLKLEGNNPAGSVKDRAALNMIIQAELRQEIAPG 63 Query: 62 DVLIEATSGNTGIALAMIAALKGYRMKLLMPDNMSQERRAAMRAYGAELILVTKEQGMEG 121 D LIEATSGNTGIALAM AA+KGY+M L+MP N +QER+ AM+AYGAEL+LV ME Sbjct: 64 DTLIEATSGNTGIALAMAAAIKGYKMILIMPSNSTQERKDAMQAYGAELLLV---DNMEA 120 Query: 122 ARDLALEMANRGEGKLLDQFNNPDNPYAHYTTTGPEIWQQTGGRITHFVSSMGTTGTITG 181 ARDLAL++ +G+GK+LDQFNN DN AH+ TTGPEIWQQ+ G+ITHFVSSMGTTGTI G Sbjct: 121 ARDLALDLQAQGKGKVLDQFNNQDNANAHFQTTGPEIWQQSQGKITHFVSSMGTTGTIMG 180 Query: 182 VSRFMREQSKPVTIVGLQPEEGSSIPGIRRWPTEYLPGIFNASLVDEVLDIHQRDAENTM 241 VS++++ ++ +TIVGLQP +GSSIPGIRRWP EYLPGIF+A+ VD V+DI ++DA+ Sbjct: 181 VSKYLKSRNPDITIVGLQPADGSSIPGIRRWPQEYLPGIFDAARVDAVMDIEEQDAKAMA 240 Query: 242 RELAVREGIFCGVSSGGAVAGALRVAKANPDAVVVAIICDRGDRYLSTGVF 292 R LA EGI GVSSGGAV AL +A+ NP +VVVAI+CDRGDRYLS+G+F Sbjct: 241 RTLAREEGICAGVSSGGAVFAALEIARQNPGSVVVAIVCDRGDRYLSSGLF 291 Lambda K H 0.316 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 326 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 303 Length of database: 292 Length adjustment: 26 Effective length of query: 277 Effective length of database: 266 Effective search space: 73682 Effective search space used: 73682 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
Align candidate 7026046 Shewana3_3188 (cysteine synthase B (RefSeq))
to HMM TIGR01138 (cysM: cysteine synthase B (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01138.hmm # target sequence database: /tmp/gapView.12831.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01138 [M=290] Accession: TIGR01138 Description: cysM: cysteine synthase B Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-144 465.2 0.2 5.6e-144 465.0 0.2 1.0 1 lcl|FitnessBrowser__ANA3:7026046 Shewana3_3188 cysteine synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__ANA3:7026046 Shewana3_3188 cysteine synthase B (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 465.0 0.2 5.6e-144 5.6e-144 1 290 [] 6 291 .. 6 291 .. 0.99 Alignments for each domain: == domain 1 score: 465.0 bits; conditional E-value: 5.6e-144 TIGR01138 1 tilklvGntplvrlkrllpeedsevlvklegnnpaGsvkdrpalsmiveaekrGeikeGdvlieatsGntGialamv 77 ti+ ++G tplvrl+rl +s+vl+klegnnpaGsvkdr+al mi++ae+r ei +Gd+lieatsGntGialam+ lcl|FitnessBrowser__ANA3:7026046 6 TIEACIGQTPLVRLQRLDCG-SSTVLLKLEGNNPAGSVKDRAALNMIIQAELRQEIAPGDTLIEATSGNTGIALAMA 81 89**************9875.789***************************************************** PP TIGR01138 78 aalkGykvkllmpdnvseerkaalkayGaelilvdkeeGmeGardlarelvrkgeeklldqfnnpdnpkahytstGi 154 aa+kGyk++l+mp+n+++erk a++ayGael+lvd+ me ardla +l+ +g++k+ldqfnn dn +ah+++tG+ lcl|FitnessBrowser__ANA3:7026046 82 AAIKGYKMILIMPSNSTQERKDAMQAYGAELLLVDN---MEAARDLALDLQAQGKGKVLDQFNNQDNANAHFQTTGP 155 **********************************86...899*********************************** PP TIGR01138 155 eiwqqtkGrithfvsslGttGtimGvsrflkeqnpavqivGlqpaegsaieGlrrieseylpgifdaslvdrvvdve 231 eiwqq++G+ithfvss+GttGtimGvs++lk +np+++ivGlqpa+gs+i+G+rr+++eylpgifda++vd v+d+e lcl|FitnessBrowser__ANA3:7026046 156 EIWQQSQGKITHFVSSMGTTGTIMGVSKYLKSRNPDITIVGLQPADGSSIPGIRRWPQEYLPGIFDAARVDAVMDIE 232 ***************************************************************************** PP TIGR01138 232 qedaediarelakkegifvGvssGgavaaalrlarelekavvvaiicdrGdrylstgvf 290 ++da+ +ar la++egi GvssGgav+aal++ar+++ +vvvai+cdrGdryls+g+f lcl|FitnessBrowser__ANA3:7026046 233 EQDAKAMARTLAREEGICAGVSSGGAVFAALEIARQNPGSVVVAIVCDRGDRYLSSGLF 291 *********************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (290 nodes) Target sequences: 1 (292 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.13 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory