GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hisH in Shewanella sp. ANA-3

Align IGP synthase glutamine amidotransferase subunit; EC 2.4.2.- (characterized)
to candidate 7024672 Shewana3_1850 imidazole glycerol phosphate synthase subunit HisH (RefSeq)

Query= CharProtDB::CH_024511
         (196 letters)



>lcl|FitnessBrowser__ANA3:7024672 Shewana3_1850 imidazole glycerol
           phosphate synthase subunit HisH (RefSeq)
          Length = 216

 Score =  195 bits (495), Expect = 6e-55
 Identities = 104/207 (50%), Positives = 140/207 (67%), Gaps = 12/207 (5%)

Query: 2   NVVILDTGCANLNSVKSAIARHGYEPKVSRDPDVVLLADKLFLPGVGTAQAAMDQVRERE 61
           +VVI+DTGCANL+SV+ A  R G +  V+ D   +  A ++ LPGVG+A AAM  + E+ 
Sbjct: 9   DVVIIDTGCANLSSVRFAFERLGAKVLVTDDKASIKAAKRVVLPGVGSAGAAMASLTEKA 68

Query: 62  LFDLIKACTQPVLGICLGMQLLGRRSEESNGVDL----LGIIDEDVPKMTDF-----GLP 112
           L +LI+  TQPVLG+CLGMQ+L   S+E  G  L    LGII  ++ ++        GLP
Sbjct: 69  LVELIQGLTQPVLGVCLGMQMLTLLSKERGGQALDCQCLGIIPTEIDELDRQILKAEGLP 128

Query: 113 LPHMGWNRVY---PQAGNRLFQGIEDGAYFYFVHSYAMPVNPWTIAQCNYGEPFTAAVQK 169
           LPHMGWN++    P   + LF G+  G+Y YFVHSY  P++ +T+AQC YGE F+AA+ K
Sbjct: 129 LPHMGWNQLTFSNPSQVHPLFTGVPAGSYVYFVHSYRAPLSDYTLAQCRYGEDFSAAIGK 188

Query: 170 DNFYGVQFHPERSGAAGAKLLKNFLEM 196
           DNF GVQFHPE+S A GA++L NFL+M
Sbjct: 189 DNFMGVQFHPEKSAAVGAQILGNFLKM 215


Lambda     K      H
   0.322    0.140    0.432 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 152
Number of extensions: 5
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 196
Length of database: 216
Length adjustment: 21
Effective length of query: 175
Effective length of database: 195
Effective search space:    34125
Effective search space used:    34125
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)

Align candidate 7024672 Shewana3_1850 (imidazole glycerol phosphate synthase subunit HisH (RefSeq))
to HMM TIGR01855 (hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit (EC 2.4.2.-))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01855.hmm
# target sequence database:        /tmp/gapView.29513.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01855  [M=198]
Accession:   TIGR01855
Description: IMP_synth_hisH: imidazole glycerol phosphate synthase, glutamine amidotransferase subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
    4.6e-65  205.2   0.0    5.2e-65  205.0   0.0    1.0  1  lcl|FitnessBrowser__ANA3:7024672  Shewana3_1850 imidazole glycerol


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7024672  Shewana3_1850 imidazole glycerol phosphate synthase subunit HisH (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  205.0   0.0   5.2e-65   5.2e-65       1     198 []      10     215 ..      10     215 .. 0.92

  Alignments for each domain:
  == domain 1  score: 205.0 bits;  conditional E-value: 5.2e-65
                         TIGR01855   1 ivvidygvgNlksvkkalervgaesevvkdskelekadklvlPGVGafkeamkklrelelellaekvvkkkkpvlgi 77 
                                       +v+id+g++Nl+sv+ a+er+ga++ v++d+ +++ a+++vlPGVG++ +am++l e+    l+e ++  ++pvlg+
  lcl|FitnessBrowser__ANA3:7024672  10 VVIIDTGCANLSSVRFAFERLGAKVLVTDDKASIKAAKRVVLPGVGSAGAAMASLTEKA---LVELIQGLTQPVLGV 83 
                                       79*******************************************************77...55888999******* PP

                         TIGR01855  78 ClGmQllfekseE.gk...evkglglikgkvkkleaek......kvPhiGWnevevvkes...ellkgleeearvYf 141
                                       ClGmQ+l   s+E g+   ++++lg+i+ +++ l+++       ++Ph+GWn++++ + s   +l++g+ ++++vYf
  lcl|FitnessBrowser__ANA3:7024672  84 CLGMQMLTLLSKErGGqalDCQCLGIIPTEIDELDRQIlkaeglPLPHMGWNQLTFSNPSqvhPLFTGVPAGSYVYF 160
                                       ***********99633222579************99888888999********98765432339************* PP

                         TIGR01855 142 vHsYaveleeeeavlakadygekfvaavekdnivgvQFHPEkSgktGlkllknflel 198
                                       vHsY+++l++  ++la++ yge+f aa+ kdn++gvQFHPEkS+++G+++l nfl++
  lcl|FitnessBrowser__ANA3:7024672 161 VHSYRAPLSD--YTLAQCRYGEDFSAAIGKDNFMGVQFHPEKSAAVGAQILGNFLKM 215
                                       *********7..9*****************************************975 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (198 nodes)
Target sequences:                          1  (216 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 6.01
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory