GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hisN in Shewanella sp. ANA-3

Align Histidine biosynthesis bifunctional protein HisB; EC 3.1.3.15; EC 4.2.1.19 (characterized)
to candidate 7024673 Shewana3_1851 imidazole glycerol-phosphate dehydratase/histidinol phosphatase (RefSeq)

Query= SwissProt::Q9S5G5
         (355 letters)



>lcl|FitnessBrowser__ANA3:7024673 Shewana3_1851 imidazole
           glycerol-phosphate dehydratase/histidinol phosphatase
           (RefSeq)
          Length = 363

 Score =  451 bits (1159), Expect = e-131
 Identities = 217/355 (61%), Positives = 268/355 (75%)

Query: 1   MSQKYLFIDRDGTLISEPPSDFQVDRFDKLAFEPGVIPQLLKLQKAGYKLVMITNQDGLG 60
           ++QK LFIDRDGTLI EP +D QVD   KL FEP VIP LL+LQKAG++LVM++NQDGLG
Sbjct: 9   VAQKILFIDRDGTLIEEPITDKQVDSLAKLVFEPQVIPALLRLQKAGFRLVMVSNQDGLG 68

Query: 61  TQSFPQADFDGPHNLMMQIFTSQGVQFDEVLICPHLPADECDCRKPKVKLVERYLAEQAM 120
           T SFPQ DFD PHN+MMQI +SQGV+F++VLICPH   + C CRKPK+ LV+ +L +  +
Sbjct: 69  TPSFPQEDFDAPHNMMMQILSSQGVKFEDVLICPHFNDENCSCRKPKLGLVKDFLTQGTI 128

Query: 121 DRANSYVIGDRATDIQLAENMGINGLRYDRETLNWPMIGEQLTRRDRYAHVVRNTKETQI 180
           D   S VIGDR TD++L   MGI   +Y R +L W  I + L  + R A VVR TKET I
Sbjct: 129 DFTQSAVIGDRHTDVELGNAMGIKSFQYQRGSLGWDAIADALLNKGRTATVVRTTKETDI 188

Query: 181 DVQVWLDREGGSKINTGVGFFDHMLDQIATHGGFRMEINVKGDLYIDDHHTVEDTGLALG 240
            V V LD      INTG+GFFDHMLDQIATHG F+ME+NV GDL IDDHH+VEDT LA+G
Sbjct: 189 RVTVDLDNPSKGAINTGIGFFDHMLDQIATHGNFKMEVNVDGDLEIDDHHSVEDTALAIG 248

Query: 241 EALKIALGDKRGICRFGFVLPMDECLARCALDISGRPHLEYKAEFTYQRVGDLSTEMIEH 300
           +AL+ ALGDKRGI RFGF LPMDE    C LD+SGRP +++ A+F  ++VG+++TEM+ H
Sbjct: 249 DALRQALGDKRGIARFGFSLPMDEAKGECLLDLSGRPFIKFAAQFEREKVGEMATEMVPH 308

Query: 301 FFRSLSYTMGVTLHLKTKGKNDHHRVESLFKAFGRTLRQAIRVEGDTLPSSKGVL 355
           FFRS +  +  TLH+  +G NDHH+VE+LFK  GR LRQA++VEGD LPSSKGVL
Sbjct: 309 FFRSFADGLRCTLHVAAEGDNDHHKVEALFKVLGRALRQAVKVEGDVLPSSKGVL 363


Lambda     K      H
   0.322    0.140    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 449
Number of extensions: 17
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 355
Length of database: 363
Length adjustment: 29
Effective length of query: 326
Effective length of database: 334
Effective search space:   108884
Effective search space used:   108884
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)

Align candidate 7024673 Shewana3_1851 (imidazole glycerol-phosphate dehydratase/histidinol phosphatase (RefSeq))
to HMM TIGR01261 (hisB: histidinol-phosphatase (EC 3.1.3.15))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01261.hmm
# target sequence database:        /tmp/gapView.7258.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01261  [M=161]
Accession:   TIGR01261
Description: hisB_Nterm: histidinol-phosphatase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
    4.3e-78  246.5   0.0    6.1e-78  246.0   0.0    1.2  1  lcl|FitnessBrowser__ANA3:7024673  Shewana3_1851 imidazole glycerol


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7024673  Shewana3_1851 imidazole glycerol-phosphate dehydratase/histidinol phosphatase (RefS
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  246.0   0.0   6.1e-78   6.1e-78       1     160 [.      11     170 ..      11     171 .. 0.99

  Alignments for each domain:
  == domain 1  score: 246.0 bits;  conditional E-value: 6.1e-78
                         TIGR01261   1 qkilfidrdGtlieePksdfqvdaleklklekkvipallklkeagyklvlvtnqdGlGtesfPkedfdkphalmlqi 77 
                                       qkilfidrdGtlieeP +d qvd+l kl +e++vipall+l++ag++lv+v+nqdGlGt+sfP+edfd ph++m+qi
  lcl|FitnessBrowser__ANA3:7024673  11 QKILFIDRDGTLIEEPITDKQVDSLAKLVFEPQVIPALLRLQKAGFRLVMVSNQDGLGTPSFPQEDFDAPHNMMMQI 87 
                                       79*************************************************************************** PP

                         TIGR01261  78 fkseGivfddvlicphfledncacrkPkiklleeylkkekidkersyviGdretdlqlaenlgirglkykeeelnwk 154
                                       ++s+G++f+dvlicphf+++nc+crkPk++l++++l + +id  +s+viGdr+td++l + +gi++++y++ +l+w+
  lcl|FitnessBrowser__ANA3:7024673  88 LSSQGVKFEDVLICPHFNDENCSCRKPKLGLVKDFLTQGTIDFTQSAVIGDRHTDVELGNAMGIKSFQYQRGSLGWD 164
                                       ***************************************************************************** PP

                         TIGR01261 155 eiakel 160
                                        ia+ l
  lcl|FitnessBrowser__ANA3:7024673 165 AIADAL 170
                                       **9987 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (161 nodes)
Target sequences:                          1  (363 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 8.64
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory