Align dihydroxy-acid dehydratase subunit (EC 4.2.1.9) (characterized)
to candidate 7024896 Shewana3_2070 dihydroxy-acid dehydratase (RefSeq)
Query= metacyc::MONOMER-11919 (549 letters) >FitnessBrowser__ANA3:7024896 Length = 586 Score = 334 bits (857), Expect = 5e-96 Identities = 204/541 (37%), Positives = 319/541 (58%), Gaps = 17/541 (3%) Query: 15 HRSLLARCGLTDDDFE-KPFIGIANSYTDIVPGHIHLRELAEAVKEGVNAAGGVAFEFNT 73 +RS + G+ + F+ KP IGI N+++++ P + HLRELA+ VK G+ AGG+ EF Sbjct: 34 YRSWMKNQGIPEHHFQNKPVIGICNTWSELTPCNGHLRELAQRVKNGIREAGGIPVEFPV 93 Query: 74 MAICDGIAMNHDGMKYSLASREIVADTVESMAMAHALDGLVLLPTCDKIVPGMLMAAARL 133 + + + ++ +R + A E + +DG+VLL CDK P +LM AA Sbjct: 94 FSNGES-----NLRPSAMLTRNLAAMDTEEAIRGNPIDGVVLLVGCDKTTPALLMGAASC 148 Query: 134 DIPAIVVTGGPMLPGEFKGRKVDLIN-VYEGVGTVSAGEMSEDELEELERCACPGPRSCA 192 D+P IVVTGGPML G+ KG+ V V+E AG +S E +C Sbjct: 149 DLPTIVVTGGPMLNGKHKGKDVGSGTLVWELHQEYKAGNISLAAFMNAEADMSRSTGTCN 208 Query: 193 GLFTANTMACLTEALGMSLPGCATAHAVSSRKRQIARLSGKRIVEMVQENLKPTMIMSQE 252 + TA+TMAC+ E LG+SLP AT AV SR++ +A +SG RIV+MV+E+L + I+S++ Sbjct: 209 TMGTASTMACMVETLGVSLPHNATIPAVDSRRQVLAHMSGMRIVDMVKEDLTLSKILSRD 268 Query: 253 AFENAVMVDLALGGSTNTTLHIPAIAAEIDGLNINLDLFDELSRVIPHIASISPAGEHMM 312 AF NA+ V+ A+GGSTN +H+ AIA I G+ ++LD + +P I ++ P+G+++M Sbjct: 269 AFINAIKVNAAIGGSTNAVIHLKAIAGRI-GVELSLDDWRH-GYTVPTIVNLKPSGQYLM 326 Query: 313 LDLDRAGGIPAVLKTLEDH--INRECVTCTGRTVQENIENVKVGHRDVIRPLDSPVHSEG 370 D AGG+PAVL+ L +H +++ +T ++ +N++ +++VI L++P+ G Sbjct: 327 EDFYYAGGLPAVLRQLFEHDLLSKNTLTVNAASLWDNVKEAPCYNQEVIMSLENPLVENG 386 Query: 371 GLAILRGNLAPRGSVVKQGAVAEDMMVHEGPAKVFNSEDECMEAIFGGR--IDEGDVIVI 428 G+ +LRGNLAPRG+V+K A + +M H G A VF S D+ I IDE ++V+ Sbjct: 387 GIRVLRGNLAPRGAVIKPSAASAHLMQHRGKAVVFESFDDYNARIGDPELDIDENSIMVL 446 Query: 429 RYEGPKGGPGMREMLNP--TSAIAGMGLERVALITDGRFSGGTRGPCVGHVSPEAMEDGP 486 + GPKG PGM E+ N + G++ + I+D R SG G V HV+PEA GP Sbjct: 447 KNCGPKGYPGMAEVGNMGLPPKLLKKGIKDMVRISDARMSGTAFGTVVLHVAPEAQALGP 506 Query: 487 LAAVNDGDIIRIDIPSRKLEVDLSPREIEERLQ--SAVKPRRSVKGWLARYRKLAGSADT 544 LAAV +GD+I +D + L++++S +E++ RL + VK G+L+ +++ AD Sbjct: 507 LAAVQNGDMIALDTYAGTLQLEISDQELQARLAKLATVKSIPVNGGYLSLFKEHVLQADE 566 Query: 545 G 545 G Sbjct: 567 G 567 Lambda K H 0.319 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 793 Number of extensions: 35 Number of successful extensions: 7 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 549 Length of database: 586 Length adjustment: 36 Effective length of query: 513 Effective length of database: 550 Effective search space: 282150 Effective search space used: 282150 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory