GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapD in Shewanella sp. ANA-3

Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase; Tetrahydrodipicolinate N-succinyltransferase; THDP succinyltransferase; THP succinyltransferase; Tetrahydropicolinate succinylase; EC 2.3.1.117 (characterized)
to candidate 7025668 Shewana3_2818 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase (RefSeq)

Query= SwissProt::P56220
         (274 letters)



>FitnessBrowser__ANA3:7025668
          Length = 274

 Score =  454 bits (1167), Expect = e-132
 Identities = 224/274 (81%), Positives = 244/274 (89%)

Query: 1   MQQLQNVIESAFERRADITPANVDTVTREAVNQVIGLLDSGALRVAEKIDGQWVTHQWLK 60
           M+ L+  IE+AFE RADITP+ VD   R  V  VI +LD G LRVAEKIDGQW  HQWLK
Sbjct: 1   MEALRQRIEAAFEARADITPSTVDASVRNDVQNVINMLDKGELRVAEKIDGQWHVHQWLK 60

Query: 61  KAVLLSFRINDNKVMDGAETRYYDKVPMKFADYDEARFQKEGFRVVPPATVRQGAFIARN 120
           KAVLLSFRI DN V+DGAET+Y+DKVP+KFA+YDEARF+ E  RVVP ATVR+G+FI +N
Sbjct: 61  KAVLLSFRIFDNAVIDGAETKYFDKVPLKFAEYDEARFKAEAIRVVPSATVRKGSFIGKN 120

Query: 121 TVLMPSYVNIGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQANPTIIED 180
           TVLMPSYVN+GAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQA PTIIED
Sbjct: 121 TVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKNVHLSGGVGIGGVLEPLQAGPTIIED 180

Query: 181 NCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEIHYGRVPAGSVVVSGNLPS 240
           NCFIGARSE+VEGV+VEEGSVISMGVY+GQSTRIYDRETGEIHYGRVPAGSVVVSGNLPS
Sbjct: 181 NCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVVSGNLPS 240

Query: 241 KDGSYSLYCAVIVKKVDAKTRGKVGINELLRTID 274
             G YSLY A+IVKKVDAKTRGKVGINELLR +D
Sbjct: 241 ACGKYSLYAAIIVKKVDAKTRGKVGINELLRIVD 274


Lambda     K      H
   0.318    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 329
Number of extensions: 5
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 274
Length of database: 274
Length adjustment: 25
Effective length of query: 249
Effective length of database: 249
Effective search space:    62001
Effective search space used:    62001
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

Align candidate 7025668 Shewana3_2818 (2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase (RefSeq))
to HMM TIGR00965 (dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00965.hmm
# target sequence database:        /tmp/gapView.3607.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00965  [M=271]
Accession:   TIGR00965
Description: dapD: 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   6.3e-154  497.2   3.1     7e-154  497.0   3.1    1.0  1  lcl|FitnessBrowser__ANA3:7025668  Shewana3_2818 2,3,4,5-tetrahydro


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__ANA3:7025668  Shewana3_2818 2,3,4,5-tetrahydropyridine-2,6-carboxylate N-succinyltransferase (Ref
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  497.0   3.1    7e-154    7e-154       2     270 ..       4     272 ..       3     273 .. 0.99

  Alignments for each domain:
  == domain 1  score: 497.0 bits;  conditional E-value: 7e-154
                         TIGR00965   2 lqkiietaferraeilpasklikvkeavnesiasldsgalrvaekldgqwkvnewvkkavllsfritdnqvlndavn 78 
                                       l++ ie afe ra+i+p+++++ v++ v+++i++ld+g lrvaek+dgqw+v++w+kkavllsfri dn v+++a++
  lcl|FitnessBrowser__ANA3:7025668   4 LRQRIEAAFEARADITPSTVDASVRNDVQNVINMLDKGELRVAEKIDGQWHVHQWLKKAVLLSFRIFDNAVIDGAET 80 
                                       6789************************************************************************* PP

                         TIGR00965  79 kyfdkvatkfadydedefkeaglrkvpgavvrrgafiaknvvlmpsyvnigayvdegtmvdtwatvgscaqigknvh 155
                                       kyfdkv+ kfa+yde++fk +++r+vp+a vr+g+fi kn+vlmpsyvn+gayvdegtmvdtwatvgscaqigknvh
  lcl|FitnessBrowser__ANA3:7025668  81 KYFDKVPLKFAEYDEARFKAEAIRVVPSATVRKGSFIGKNTVLMPSYVNLGAYVDEGTMVDTWATVGSCAQIGKNVH 157
                                       ***************************************************************************** PP

                         TIGR00965 156 lsggvgiggvleplqakpviiedncfigarseivegviveegsvismgvfigqstkivdretgeiiygrvpagsvvv 232
                                       lsggvgiggvleplqa p+iiedncfigarseivegv+veegsvismgv+igqst+i+dretgei+ygrvpagsvvv
  lcl|FitnessBrowser__ANA3:7025668 158 LSGGVGIGGVLEPLQAGPTIIEDNCFIGARSEIVEGVVVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVPAGSVVV 234
                                       ***************************************************************************** PP

                         TIGR00965 233 sgslpskdgkkslycavivkkvdaktrgkvsinellrt 270
                                       sg+lps  gk+sly a+ivkkvdaktrgkv+inellr 
  lcl|FitnessBrowser__ANA3:7025668 235 SGNLPSACGKYSLYAAIIVKKVDAKTRGKVGINELLRI 272
                                       ************************************95 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (271 nodes)
Target sequences:                          1  (274 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 6.83
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory