Align succinyl-diaminopimelate desuccinylase (EC 3.5.1.18) (characterized)
to candidate 7024734 Shewana3_1912 succinyl-diaminopimelate desuccinylase (RefSeq)
Query= BRENDA::Q9KQ52 (377 letters) >FitnessBrowser__ANA3:7024734 Length = 381 Score = 522 bits (1344), Expect = e-153 Identities = 255/372 (68%), Positives = 293/372 (78%) Query: 5 PVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQSPLFV 64 PV L KELI+R SVTP D GCQ LM ERL A+GF IE MVFEDTTN WARRG + P+F Sbjct: 9 PVTELTKELIARPSVTPLDEGCQTLMAERLAAIGFNIEPMVFEDTTNMWARRGNEGPVFC 68 Query: 65 FAGHTDVVPAGPLSQWHTPPFEPTVIDGFLHGRGAADMKGSLACMIVAVERFIAEHPDHQ 124 FAGHTDVVPAG LS+WHTPPFEPT+IDG+L+GRGAADMKGSLA MIVA ERF+A+HP+H Sbjct: 69 FAGHTDVVPAGDLSRWHTPPFEPTIIDGYLYGRGAADMKGSLAAMIVATERFVAKHPNHP 128 Query: 125 GSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRRGSIT 184 GSI FLITSDEEGPFINGT RV++TL ARNE I +VGEPSSTL +GDVVKNGRRGS+T Sbjct: 129 GSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWTLVGEPSSTLKLGDVVKNGRRGSLT 188 Query: 185 GDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQAGTGA 244 +L VKG QGHVAYPHLA+NP+HKA P LAEL+ T WD GN +FPPTS QI N+ GTGA Sbjct: 189 ANLTVKGIQGHVAYPHLADNPIHKAAPFLAELSQTHWDNGNEFFPPTSMQIANINGGTGA 248 Query: 245 SNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYDVKWTLSGQPFLTDTGELLA 304 SNVIPG +V FNFR+STE+T E + RV ++L AH LDYD+ WT +G PFLT G LL Sbjct: 249 SNVIPGTLEVMFNFRYSTEVTAEILIERVEALLTAHELDYDISWTFNGLPFLTGEGPLLD 308 Query: 305 AVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIADLEKL 364 A A+ ++ TTGGTSDGRFIA GA+V+ELGPVNATIHKVNECV+I DLE+L Sbjct: 309 ATRHAIRQITGYDTDPQTTGGTSDGRFIAPTGAKVLELGPVNATIHKVNECVKIDDLEQL 368 Query: 365 TDMYQKTLNHLL 376 Y+ L LL Sbjct: 369 ALCYEVILEQLL 380 Lambda K H 0.318 0.135 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 506 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 377 Length of database: 381 Length adjustment: 30 Effective length of query: 347 Effective length of database: 351 Effective search space: 121797 Effective search space used: 121797 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 7024734 Shewana3_1912 (succinyl-diaminopimelate desuccinylase (RefSeq))
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.13690.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-174 565.1 0.0 3.7e-174 564.9 0.0 1.0 1 lcl|FitnessBrowser__ANA3:7024734 Shewana3_1912 succinyl-diaminopi Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__ANA3:7024734 Shewana3_1912 succinyl-diaminopimelate desuccinylase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 564.9 0.0 3.7e-174 3.7e-174 1 370 [] 10 379 .. 10 379 .. 1.00 Alignments for each domain: == domain 1 score: 564.9 bits; conditional E-value: 3.7e-174 TIGR01246 1 vlelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgteepvlvfaGhtDvvPaGelekWss 77 v+el+keLi r+svtP d+g+q l+aerL ++gf+ie + fedt+n+wa+rg e pv++faGhtDvvPaG+l++W++ lcl|FitnessBrowser__ANA3:7024734 10 VTELTKELIARPSVTPLDEGCQTLMAERLAAIGFNIEPMVFEDTTNMWARRGNEGPVFCFAGHTDVVPAGDLSRWHT 86 589************************************************************************** PP TIGR01246 78 dpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtkkvvetlkerdelidy 154 +pfep+++dG+lygrGaaDmkgslaa++va+erfv+k+++h Gs+++litsDeeg +i+Gt++v++tl++r+e+i++ lcl|FitnessBrowser__ANA3:7024734 87 PPFEPTIIDGYLYGRGAADMKGSLAAMIVATERFVAKHPNHPGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITW 163 ***************************************************************************** PP TIGR01246 155 avvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGneffppsslqia 231 ++vgePss+ klGDv+k+GrrGs+t++l++kGiqGhvaYPh+a+nP+hka+p+l+el ++++D+Gneffpp+s+qia lcl|FitnessBrowser__ANA3:7024734 164 TLVGEPSSTLKLGDVVKNGRRGSLTANLTVKGIQGHVAYPHLADNPIHKAAPFLAELSQTHWDNGNEFFPPTSMQIA 240 ***************************************************************************** PP TIGR01246 232 nieagtgasnviPgelkvkfnlrfssevseeelkskvekildkhkldYelewklsgepfltkegklikkvaeaieev 308 ni++gtgasnviPg l+v+fn+r+s+ev++e l ++ve++l +h+ldY++ w++ g pflt eg l+++ ++ai+++ lcl|FitnessBrowser__ANA3:7024734 241 NINGGTGASNVIPGTLEVMFNFRYSTEVTAEILIERVEALLTAHELDYDISWTFNGLPFLTGEGPLLDATRHAIRQI 317 ***************************************************************************** PP TIGR01246 309 lkkkpelstsGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsevyeklleel 370 ++ ++ +t+GGtsD+rfia ga+v+elG+vn+tihkvne+vki+dle+l+ ye +le+l lcl|FitnessBrowser__ANA3:7024734 318 TGYDTDPQTTGGTSDGRFIAPTGAKVLELGPVNATIHKVNECVKIDDLEQLALCYEVILEQL 379 **********************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (381 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.69 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory