Align 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; L-2AA aminotransferase; EC 2.6.1.39 (characterized)
to candidate 7023380 Shewana3_0610 bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein (RefSeq)
Query= SwissProt::Q88FI7 (416 letters) >FitnessBrowser__ANA3:7023380 Length = 405 Score = 196 bits (499), Expect = 8e-55 Identities = 134/402 (33%), Positives = 200/402 (49%), Gaps = 36/402 (8%) Query: 21 GRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPHGPYLAL 80 G + VWD +G +IDF GGI V LGHC+PA+V A++ Q +L H + N + P L L Sbjct: 30 GEGSRVWDQEGNEFIDFAGGIAVNCLGHCHPALVNALKTQGEKLWHLS-NVMTNEPALEL 88 Query: 81 MEQLSQFVPVSYPLAGMLTNSGAEAAENALKVARG------ATGKRAIIAFDGGFHGRTL 134 +L V ++ NSGAEA E ALK+AR K IIAFD FHGRT Sbjct: 89 ATKL---VNSTFAERVYFANSGAEANEAALKLARRYALEKFGVEKDEIIAFDKAFHGRTF 145 Query: 135 ATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSVELAVED-VAA 193 T+++ G+ A Y G P + HLPY + + ++E AV D A Sbjct: 146 FTVSVGGQAA-YSDGFGPKPQSITHLPY----------------NDVAALEAAVSDKTCA 188 Query: 194 FIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAFPRLGIEPD 253 + EP+QGEGG + DPAF +A+R ++ L+I DE+Q+G GRTG+ +A+ I PD Sbjct: 189 IMLEPLQGEGGIIDADPAFLKAVRELANKHNALVIFDEVQTGVGRTGELYAYMGTDIVPD 248 Query: 254 LLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASLAQMTDENLAT 313 +L AK++ GG P+ A++ E+ L G G TY GNP++CA A L + + Sbjct: 249 ILTTAKALGGGFPIAAMLTTAEIAEHLKVGTHGSTYGGNPLACAIGNAVLDVVNTPEVLN 308 Query: 314 WGERQEQAIVSRYERWKASGLSPYIGRLTGVGAMRGIEFANADGSPAPAQLAKVMEAARA 373 + +EQ + R K + + G G + G + + A+ A Sbjct: 309 GVKHREQLL--RDGLNKINEKYHVFSEIRGKGLLLGAVL----NEQYQGRSRDFLVASVA 362 Query: 374 RGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCLAEL 415 GL+ + +G +++R L I + EGL E+ +A + Sbjct: 363 EGLMSLMAG--ANVVRFAPSLVIPEADIAEGLARFERAVASI 402 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 405 Length adjustment: 31 Effective length of query: 385 Effective length of database: 374 Effective search space: 143990 Effective search space used: 143990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory