GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asp-kinase in Shewanella sp. ANA-3

Align aspartate kinase (EC 2.7.2.4) (characterized)
to candidate 7023422 Shewana3_0652 aspartate kinase III (RefSeq)

Query= BRENDA::P08660
         (449 letters)



>FitnessBrowser__ANA3:7023422
          Length = 451

 Score =  517 bits (1331), Expect = e-151
 Identities = 272/447 (60%), Positives = 339/447 (75%), Gaps = 1/447 (0%)

Query: 4   IVVSKFGGTSVADFDAMNRSADIVLSDANVRLVVLSASAGITNLLVALA-EGLEPGERFE 62
           +VV+KFGGTSVAD+ AMNR ADIVL + + RLVV+SAS+G+TNLLV L  E +    R +
Sbjct: 3   LVVAKFGGTSVADYGAMNRCADIVLGNPDCRLVVVSASSGVTNLLVELTQESMNDDGRLQ 62

Query: 63  KLDAIRNIQFAILERLRYPNVIREEIERLLENITVLAEAAALATSPALTDELVSHGELMS 122
           +L  I  IQ+AIL++L  PN +   +++LL  + VL+EA A   S A  DEL+S GE  S
Sbjct: 63  RLKQIAQIQYAILDKLGRPNDVAAALDKLLSRMAVLSEALASQRSKATMDELLSLGEQCS 122

Query: 123 TLLFVEILRERDVQAQWFDVRKVMRTNDRFGRAEPDIAALAELAALQLLPRLNEGLVITQ 182
           + LF  +LRE+   +  FDVR+V+RT+  FGRAEP +  +A L+   LLP L+E +++TQ
Sbjct: 123 SALFAAVLREKGANSSAFDVRRVLRTDSHFGRAEPQVEQIAILSREHLLPLLSEQVIVTQ 182

Query: 183 GFIGSENKGRTTTLGRGGSDYTAALLAEALHASRVDIWTDVPGIYTTDPRVVSAAKRIDE 242
           GFIGS+  G+TTTLGRGGSDY+AALLAEAL AS V+IWTDV GIYTTDPR+   A  I E
Sbjct: 183 GFIGSDEAGQTTTLGRGGSDYSAALLAEALKASAVEIWTDVAGIYTTDPRLAPNAHPIAE 242

Query: 243 IAFAEAAEMATFGAKVLHPATLLPAVRSDIPVFVGSSKDPRAGGTLVCNKTENPPLFRAL 302
           I+F EAAEMATFGAKVLHPAT+LPAVR  I VFVGSSK+P  GGT + ++ E+ P+FRA+
Sbjct: 243 ISFNEAAEMATFGAKVLHPATILPAVRQQIQVFVGSSKEPEKGGTWIRHQVEDAPVFRAV 302

Query: 303 ALRRNQTLLTLHSLNMLHSRGFLAEVFGILARHNISVDLITTSEVSVALTLDTTGSTSTG 362
           ALRR+QTLL LHSL MLH++GFLAE F  LARH ISVDLITTSEV+V+LTLD TGS S+G
Sbjct: 303 ALRRDQTLLNLHSLQMLHAQGFLAETFATLARHKISVDLITTSEVNVSLTLDKTGSDSSG 362

Query: 363 DTLLTQSLLMELSALCRVEVEEGLALVALIGNDLSKACGVGKEVFGVLEPFNIRMICYGA 422
             LL+++LL ELS  CRV VE+GLALVA+IGN ++   G+ + VF VLEP N+RMIC GA
Sbjct: 363 QGLLSEALLQELSQHCRVRVEDGLALVAIIGNRIATTAGICRRVFEVLEPHNVRMICQGA 422

Query: 423 SSHNLCFLVPGEDAEQVVQKLHSNLFE 449
           S HNLC LV   +A QVV+ LH NLFE
Sbjct: 423 SPHNLCVLVAESEAAQVVKALHENLFE 449


Lambda     K      H
   0.320    0.135    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 506
Number of extensions: 9
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 449
Length of database: 451
Length adjustment: 33
Effective length of query: 416
Effective length of database: 418
Effective search space:   173888
Effective search space used:   173888
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate 7023422 Shewana3_0652 (aspartate kinase III (RefSeq))
to HMM TIGR00656 (aspartate kinase, monofunctional class (EC 2.7.2.4))

Software error:

../bin/blast/fastacmd -i /tmp/list.7345.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.7345.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.