GapMind for Amino acid biosynthesis

 

Alignments for a candidate for asp-kinase in Shewanella sp. ANA-3

Align Aspartate kinase; Aspartokinase; EC 2.7.2.4 (characterized)
to candidate 7023909 Shewana3_1129 aspartate kinase (RefSeq)

Query= SwissProt::Q88EI9
         (411 letters)



>FitnessBrowser__ANA3:7023909
          Length = 418

 Score =  338 bits (867), Expect = 2e-97
 Identities = 195/405 (48%), Positives = 273/405 (67%), Gaps = 3/405 (0%)

Query: 3   LIVQKFGGTSVGSIERIEQVAEKVKKHREAGDDLVVVLSAMSGETNRLIDLAKQITDQPV 62
           L V+KFGGTSVGSIERIE VAE++ K    G+  V+VLSAM+GETNRL  LA QI  +  
Sbjct: 12  LFVKKFGGTSVGSIERIEVVAEQIAKSAHNGELQVLVLSAMAGETNRLFALAAQIDPRAS 71

Query: 63  PRELDVIVSTGEQVTIALLTMALIKRGVPAVSYTGNQVRILTDSSHNKARILQIDDQKIR 122
            RELD++VSTGEQ++IAL+ MAL +RG+ A S TG+QV+I T+S   +A I ++D   + 
Sbjct: 72  ARELDMLVSTGEQISIALMAMALQRRGINARSLTGDQVQIHTNSQFGRASIERVDTAYLT 131

Query: 123 ADLKEGRVVVVAGFQGVDEHGSITTLGRGGSDTTGVALAAALKADECQIYTDVDGVYTTD 182
           + L +G V +VAGFQG+D +G +TTLGRGGSDTT VALAAALKADECQI+TDV GV+TTD
Sbjct: 132 SLLNDGIVPIVAGFQGIDPNGDVTTLGRGGSDTTAVALAAALKADECQIFTDVPGVFTTD 191

Query: 183 PRVVPQARRLEKITFEEMLEMASLGSKVLQIRSVEFAGKYNVPLRVLHSFKEGPGTLITI 242
           P +   ARRL+ I F+ MLEMA LG+KVL   SVE+A ++ VPLRVL SF+ G GTLI  
Sbjct: 192 PNIDSSARRLDVIGFDVMLEMAKLGAKVLHPDSVEYAQRFKVPLRVLSSFEAGHGTLIQF 251

Query: 243 -DEEESMEQPIISGIAFNRDEAKLTIRGVPDTPGVAFKILGPISASNIEVDMIVQNVAHD 301
            DE E      + GIA N+  A LTI+G+  +      +L  ++   I+V+ I     ++
Sbjct: 252 GDESELAMAASVQGIAINKALATLTIKGLFTSSEHYQALLACLARLEIDVEFITPLKLNE 311

Query: 302 NTTD--FTFTVHRNEYEKAQSVLENTAREIGAREVIGDTKIAKVSIVGVGMRSHAGVASC 359
            +     +F +   + +     LE  +  +   ++I + + AKVS+VG G+++  G+ + 
Sbjct: 312 TSAAECVSFMLAEAKVDILLHELELLSESLDLGQLIVERQRAKVSLVGKGLQAKVGLLTK 371

Query: 360 MFEALAKESINIQMISTSEIKVSVVLEEKYLELAVRALHTAFDLD 404
           M + L  E+I+ +++STSE K+S V++E+ L  AVRALH AF+L+
Sbjct: 372 MLDVLGNETIHAKLLSTSESKLSTVIDERDLHKAVRALHHAFELN 416


Lambda     K      H
   0.316    0.133    0.358 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 421
Number of extensions: 10
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 411
Length of database: 418
Length adjustment: 31
Effective length of query: 380
Effective length of database: 387
Effective search space:   147060
Effective search space used:   147060
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

Align candidate 7023909 Shewana3_1129 (aspartate kinase (RefSeq))
to HMM TIGR00657 (aspartate kinase (EC 2.7.2.4))

Software error:

../bin/blast/fastacmd -i /tmp/list.2590.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.2590.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.