Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate BPHYT_RS11720 BPHYT_RS11720 acetylornithine deacetylase
Query= BRENDA::Q92Y75 (374 letters) >FitnessBrowser__BFirm:BPHYT_RS11720 Length = 387 Score = 299 bits (766), Expect = 8e-86 Identities = 156/372 (41%), Positives = 223/372 (59%), Gaps = 10/372 (2%) Query: 6 ILGKLVGFRSVVGLPNNDVVSWIRGYLESHGIAVDVLPGPEGDRSNIFATIGPKEARGYI 65 +L +L+GF +V N +++ +IRGYL G+ ++ E ++N+FATIGP+E G + Sbjct: 9 LLERLIGFATVSRDSNLEMIDFIRGYLGELGVESELFYNAERSKANLFATIGPREGGGIV 68 Query: 66 ISGHMDVVPAAETGWTSDPFRLRVEADRLYGRGTTDMKGFLAAVLAAVPKLAAMPLRRPL 125 +SGH DVVP WT D FRL RLYGRG DMKG++A+VLAAVP L L+ P+ Sbjct: 69 LSGHTDVVPVEGQAWTVDAFRLTERDGRLYGRGAADMKGYIASVLAAVPGLRERELKLPV 128 Query: 126 HLALSYDEEAGCRGVPHMIARLPELCRQPLGAIIGEPTGMRAIRAHKGKAAARLTVRGRS 185 HLA SYDEE GC GV M+A L + +P +IGEPT ++ + HKGK A R V+G Sbjct: 129 HLAFSYDEEVGCLGVRPMLAELAQRAHKPALCLIGEPTELKPVLGHKGKLAMRCQVKGAP 188 Query: 186 GHSSRPDQGLNAIHGVAGVLTQAVAEADRLVGGPFEH--VFEPPYSSLQIGTVKGGQAVN 243 HS+ G+NAI A ++ + + E L+ P H F+PP+S++Q G + GG+A+N Sbjct: 189 CHSAYAPYGVNAIQYAARMIGR-LEEIGELLARPEHHDARFDPPFSTVQTGVINGGRALN 247 Query: 244 IIPDSCEVEFEARAISGVDPAELLAPVRKTAEA-------LTTLGFEVEWQELSAYPALS 296 I+P CE +FE RA+ G D + ++ AEA ++ +Q LSAYP L+ Sbjct: 248 IVPAECEFDFEVRALPGFDANRVADELQIYAEAELLPKMRAVKSDTDIRFQSLSAYPGLA 307 Query: 297 LEPDAPLAALLEELTGREALPAVSYGTEAGLFQRAGIDAIICGPGDIGRAHKPDEYILID 356 PD+ A LL L+G V++GTE GLF AGI ++CGPG + + HKPDE++ + Sbjct: 308 TSPDSEAARLLALLSGSTEYGTVAFGTEGGLFDEAGIPTVVCGPGSMDQGHKPDEFVTVA 367 Query: 357 ELMACRAMVEAL 368 +L C AM+ L Sbjct: 368 QLRECDAMLARL 379 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 413 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 387 Length adjustment: 30 Effective length of query: 344 Effective length of database: 357 Effective search space: 122808 Effective search space used: 122808 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate BPHYT_RS11720 BPHYT_RS11720 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.6722.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.3e-129 417.0 0.0 3.8e-129 416.8 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS11720 BPHYT_RS11720 acetylornithine de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS11720 BPHYT_RS11720 acetylornithine deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 416.8 0.0 3.8e-129 3.8e-129 2 364 .. 9 379 .. 8 380 .. 0.97 Alignments for each domain: == domain 1 score: 416.8 bits; conditional E-value: 3.8e-129 TIGR01892 2 ilakLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGhtDvv 71 +l++L++f +vs+ sn+++i+++++yl elgv+ e +a+ k nl+a+iGp+e gg+vlsGhtDvv lcl|FitnessBrowser__BFirm:BPHYT_RS11720 9 LLERLIGFATVSRDSNLEMIDFIRGYLGELGVESELFYNAER-SKANLFATIGPRE-GGGIVLSGHTDVV 76 6899************************************99.*************.79*********** PP TIGR01892 72 PvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGakkl 141 Pv+++aWt D+frLte+dgrLYgrG+aDmkG++a vLaavp l +Lk P+hl++s+Deevg++G++ + lcl|FitnessBrowser__BFirm:BPHYT_RS11720 77 PVEGQAWTVDAFRLTERDGRLYGRGAADMKGYIASVLAAVPGLRERELKLPVHLAFSYDEEVGCLGVRPM 146 ********************************************************************** PP TIGR01892 142 ieala...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlvalad 208 ++ la ++pal ++GePt+l++v hkGk +++ +v+G hs+++ Gv+ai+ aa++++rl++ + lcl|FitnessBrowser__BFirm:BPHYT_RS11720 147 LAELAqraHKPALCLIGEPTELKPVLGHKGKLAMRCQVKGAPCHSAYAPYGVNAIQYAARMIGRLEEIGE 216 *99997778899********************************************************** PP TIGR01892 209 klkr.edleeaFtppyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaee.....v 272 l r e+++ F+pp++t++ G+++GG+a ni++a+Ce+ +e+R++pG d +++ +l+ ae+ + lcl|FitnessBrowser__BFirm:BPHYT_RS11720 217 LLARpEHHDARFDPPFSTVQTGVINGGRALNIVPAECEFDFEVRALPGFDANRVADELQIYAEAellpkM 286 ****999999*************************************************99998888766 PP TIGR01892 273 kekapgfevkveelsatpaleleedaelvalleklaGa.aaevvsygteagllqelGieavvlGPGdidq 341 ++ + +++++ + lsa+p+l++ +d+e+++ll+ l+G+ + +v++gte gl+ e+Gi++vv+GPG++dq lcl|FitnessBrowser__BFirm:BPHYT_RS11720 287 RAVKSDTDIRFQSLSAYPGLATSPDSEAARLLALLSGStEYGTVAFGTEGGLFDEAGIPTVVCGPGSMDQ 356 6777788889999*************************8999**************************** PP TIGR01892 342 ahqpdeYveieelkrcrallerl 364 h+pde+v + +l++c+a+l+rl lcl|FitnessBrowser__BFirm:BPHYT_RS11720 357 GHKPDEFVTVAQLRECDAMLARL 379 ********************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (387 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.04 # Mc/sec: 2.93 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory