Align periplasmic dehydroquinate dehydratase (EC 4.2.1.10) (characterized)
to candidate BPHYT_RS20430 BPHYT_RS20430 3-dehydroquinate dehydratase
Query= metacyc::MONOMER-15328 (160 letters) >FitnessBrowser__BFirm:BPHYT_RS20430 Length = 151 Score = 139 bits (349), Expect = 3e-38 Identities = 67/137 (48%), Positives = 92/137 (67%) Query: 16 LITVLNGPNLNMLGLRQPGIYGHATLDDVEQVCIQAAERLDVAIDFRQTNGEGELVSWVQ 75 L+ VLNG NLNMLG R+P +YG TL ++Q A RL++ +FRQTN E +V W+Q Sbjct: 4 LVYVLNGSNLNMLGKREPHLYGTTTLAQIQQQVEALAVRLELQCEFRQTNSEATMVDWLQ 63 Query: 76 ECRGRADGIVINPAAYGHTSIALLDALLAVELPVIEVHISNIHRREPFRHHTYVSQAAIG 135 E R ++INPA + S+ + DA+ +E P+IE+HI+NIH+R+ H+ VS+AA G Sbjct: 64 EAFERDAAVIINPAGFSFASVPVFDAVKLIERPLIELHITNIHKRDETYRHSLVSRAATG 123 Query: 136 VICGLGVRGYAHALQAI 152 VICGLG GY ALQA+ Sbjct: 124 VICGLGANGYLVALQAM 140 Lambda K H 0.322 0.139 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 94 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 160 Length of database: 151 Length adjustment: 17 Effective length of query: 143 Effective length of database: 134 Effective search space: 19162 Effective search space used: 19162 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory