Align shikimate dehydrogenase (EC 1.1.1.25) (characterized)
to candidate BPHYT_RS16975 BPHYT_RS16975 shikimate 5-dehydrogenase
Query= BRENDA::Q88RQ5 (274 letters) >FitnessBrowser__BFirm:BPHYT_RS16975 Length = 287 Score = 265 bits (678), Expect = 6e-76 Identities = 154/277 (55%), Positives = 179/277 (64%), Gaps = 10/277 (3%) Query: 2 DQYVVFGNPIGHSKSPLIHRLFAEQTGQDLEYATLLAPLDEFSDCARGFFKQGSGG-NVT 60 D+Y V GNP+GHSKSP IH FA QTG+ +EY LLAP+D F R F G G NVT Sbjct: 8 DRYAVIGNPVGHSKSPFIHGRFAAQTGEAVEYGHLLAPVDAFVPHVRAFIDAGGRGLNVT 67 Query: 61 VPFKEEAFRLCDSLTPRARRAGAVNTLSKLADGTLQGDNTDGAGLVRDLTVNAGVELAGK 120 VPFK +A D+L+PRA AGAVNTL A+G + GDNTDG GLVRD+ VN GV L G Sbjct: 68 VPFKLDAHAFADTLSPRAAAAGAVNTLRFDANG-IYGDNTDGFGLVRDIEVNLGVSLKGA 126 Query: 121 RILILGAGGAVRGVLEPILAHKPQSLVIANRTVEKAEQLAREFDELGPVVA------SGF 174 RIL+LGAGGA RGV+ P+L P +L I NRT EKAE L +F + A S Sbjct: 127 RILLLGAGGAARGVVLPMLDRAPHTLTIVNRTAEKAEALVAQFAQAARDAACQLSGGSAR 186 Query: 175 AWLQEPVDVIINATSASLAGELPPIADSLVEAGRTVCYDMMYGKEPTPFCQWATKLGAAK 234 A DVI+NAT+ SL LP D G T+ YDMMYG PT F + A KLG A+ Sbjct: 187 AIEAGTYDVIVNATAGSLDASLPECDDRAFGNG-TLAYDMMYGAHPTVFMEHARKLG-AR 244 Query: 235 VLDGLGMLAEQAAEAFFIWRGVRPDTAPVLAELRRQL 271 DGLGML EQAAE+F++WRGVRPD APVLAELR L Sbjct: 245 GADGLGMLVEQAAESFYVWRGVRPDGAPVLAELRALL 281 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 13 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 274 Length of database: 287 Length adjustment: 26 Effective length of query: 248 Effective length of database: 261 Effective search space: 64728 Effective search space used: 64728 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate BPHYT_RS16975 BPHYT_RS16975 (shikimate 5-dehydrogenase)
to HMM TIGR00507 (aroE: shikimate dehydrogenase (EC 1.1.1.25))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00507.hmm # target sequence database: /tmp/gapView.17746.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00507 [M=270] Accession: TIGR00507 Description: aroE: shikimate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2e-78 249.2 0.0 2.3e-78 249.1 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS16975 BPHYT_RS16975 shikimate 5-dehydr Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS16975 BPHYT_RS16975 shikimate 5-dehydrogenase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 249.1 0.0 2.3e-78 2.3e-78 3 267 .. 10 279 .. 8 282 .. 0.92 Alignments for each domain: == domain 1 score: 249.1 bits; conditional E-value: 2.3e-78 TIGR00507 3 lgviGnpikhSksplihnaalkqlgleleYlafeveieelekalsgikalglkGvnvTvPfKeevlellD 72 ++viGnp+ hSksp+ih ++++q+g ++eY ++ ++++++ + ++ +g +G+nvTvPfK + +++D lcl|FitnessBrowser__BFirm:BPHYT_RS16975 10 YAVIGNPVGHSKSPFIHGRFAAQTGEAVEYGHLLAPVDAFVPHVRAFIDAGGRGLNVTVPFKLDAHAFAD 79 9********************************************************************* PP TIGR00507 73 eieesakligavNTlkledgklvgynTDgiGlvssLek.lsklksekrvliiGAGGaakavaleLlka.d 140 ++++a+++gavNTl+ + + ++g+nTDg Glv ++e l ++ r+l++GAGGaa++v+l++l+ + lcl|FitnessBrowser__BFirm:BPHYT_RS16975 80 TLSPRAAAAGAVNTLRFDANGIYGDNTDGFGLVRDIEVnLGVSLKGARILLLGAGGAARGVVLPMLDRaP 149 *************************************98887666******************9886659 PP TIGR00507 141 keviiaNRtvekaeelaerlqe..lgeilal...sleevelkkvdliinatsaglsgeideaevkaellk 205 ++++i+NRt ekae+l+ ++++ ++l s +e ++d+i+nat+ +l + +e + + lcl|FitnessBrowser__BFirm:BPHYT_RS16975 150 HTLTIVNRTAEKAEALVAQFAQaaRDAACQLsggSARAIEAGTYDVIVNATAGSLDASL--PECDDRAFG 217 ********************99443333444111345678888****************..99******* PP TIGR00507 206 egklvvDlvynpletpllkeakkkgtkvidGlgMlvaQaalsFelwtgvepdvekvfealke 267 +g+l++D++y t++++ a+k+g++ +dGlgMlv+Qaa sF +w+gv pd v l++ lcl|FitnessBrowser__BFirm:BPHYT_RS16975 218 NGTLAYDMMYGAHPTVFMEHARKLGARGADGLGMLVEQAAESFYVWRGVRPDGAPVLAELRA 279 ***************************************************99888777665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (287 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 6.49 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory