Align shikimate dehydrogenase (EC 1.1.1.25); quinate/shikimate dehydrogenase (EC 1.1.1.282) (characterized)
to candidate BPHYT_RS22685 BPHYT_RS22685 shikimate 5-dehydrogenase
Query= BRENDA::Q88K85 (282 letters) >FitnessBrowser__BFirm:BPHYT_RS22685 Length = 304 Score = 334 bits (857), Expect = 1e-96 Identities = 168/274 (61%), Positives = 203/274 (74%) Query: 7 LAGLIGRGIQLSRTPALHEHEGDAQALRYLYRLIDADQLQLDDSALPGLLEAAQHTGFTG 66 L GLIG GI S TPA+HE EG L Y+YR ID + L+LD +ALP LL AA+ GF G Sbjct: 27 LVGLIGAGIGGSLTPAMHEEEGSKLGLHYVYRRIDLEALKLDVAALPDLLMAAERMGFNG 86 Query: 67 LNITYPFKQAILPLLDELSDEARGIGAVNTVVLKDGKRVGHNTDCLGFAEGLRRGLPDVA 126 LNITYP KQA++PLLDELSD+AR +GAVNTV+ KDG+R+GHNTD GFA +RGLPDV+ Sbjct: 87 LNITYPCKQAVIPLLDELSDDARALGAVNTVLFKDGRRIGHNTDWSGFARAFQRGLPDVS 146 Query: 127 RRQVVQMGAGGAGSAVAHALLGEGVERLVLFEVDATRAQALVDNLNTHFGAERAVLGTDL 186 +VVQ+GAGGAG+AVAHA L G + L LF+VDATRA +L D L F A G+ L Sbjct: 147 LERVVQLGAGGAGAAVAHAALNMGAKSLTLFDVDATRAASLADELQKRFPAAAVGAGSSL 206 Query: 187 ATALAEADGLVNTTPVGMAKLPGTPLPVELLHPRLWVAEIIYFPLETELLRAARALGCRT 246 A +LA A+GL++ TP GMAKLPG PLPVELLH LWVA+I+YFP+ T LL+AA ALGCRT Sbjct: 207 AESLAAANGLIHATPTGMAKLPGLPLPVELLHRDLWVADIVYFPIRTALLQAAEALGCRT 266 Query: 247 LDGSNMAVFQAVKAFELFSGRQADAARMQAHFAS 280 L G MAV+QAV A +F+G + DA R+ HF S Sbjct: 267 LSGGGMAVYQAVDAMRIFTGLEPDAERVYTHFQS 300 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 240 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 304 Length adjustment: 26 Effective length of query: 256 Effective length of database: 278 Effective search space: 71168 Effective search space used: 71168 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory