Align shikimate dehydrogenase (NADP+) (EC 1.1.1.25); quinate/shikimate dehydrogenase [NAD(P)+] (EC 1.1.1.282) (characterized)
to candidate BPHYT_RS28720 BPHYT_RS28720 shikimate dehydrogenase
Query= BRENDA::Q88JP1 (269 letters) >FitnessBrowser__BFirm:BPHYT_RS28720 Length = 278 Score = 151 bits (382), Expect = 1e-41 Identities = 92/262 (35%), Positives = 134/262 (51%), Gaps = 4/262 (1%) Query: 2 IRGSTELVAIVGSPIAQVKSPQNFNTWFNHNNCNLAMLPIDLHEAALDSFADTLRGWQNL 61 I G+T L +VG P+ KSPQ N F + +P ++ A L +F R NL Sbjct: 5 ITGTTRLYGLVGDPLTAAKSPQLLNQLFTEQRVDAVCVPFWVNAANLPAFVSGARAMGNL 64 Query: 62 RGCVVTVPYKQALANRVDGLSERAAALGSINVIRRERDGRLLGDNVDGAGFLGAAHKHGF 121 G +VT+P+KQ + VD L A +G++NVIR E DGR +G DG G + G Sbjct: 65 SGMLVTMPHKQRMLALVDELDPTARQVGALNVIRCEPDGRWIGAIFDGVGCVLGMQWEGN 124 Query: 122 EPAGKRALVIGCGGVGSAIAYALAEAGIASITLCDPSTARMGAVCELLGNGFPGLTVSTQ 181 PA K L++G GG GSAIA+A+A AG +++T+ D AR G + + G + Sbjct: 125 HPANKSVLLVGAGGAGSAIAFAVAAAGASNLTISDVDEARAGGLAASVA-AETGCDARSG 183 Query: 182 FSGLEDFDLVANASPVGMGTRAELPLSAALLATLQPDTLVADVVTSPEITPLLNRARQVG 241 + F++V NA+P+GM +P+ LA +V D++ + E TPL A+ G Sbjct: 184 PPDPQGFEIVINATPLGMKANDAMPVDPERLA---HGAIVVDIINAAEPTPLRRAAQARG 240 Query: 242 CRIQTGPEMAFAQLGHLGAFMG 263 CR Q G M Q + F+G Sbjct: 241 CRTQDGGPMHRGQAVYALRFLG 262 Lambda K H 0.320 0.137 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 269 Length of database: 278 Length adjustment: 25 Effective length of query: 244 Effective length of database: 253 Effective search space: 61732 Effective search space used: 61732 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory