Align 3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54) (characterized)
to candidate BPHYT_RS03535 BPHYT_RS03535 phospho-2-dehydro-3-deoxyheptonate aldolase
Query= BRENDA::C3TIE2 (350 letters) >FitnessBrowser__BFirm:BPHYT_RS03535 Length = 357 Score = 473 bits (1216), Expect = e-138 Identities = 231/347 (66%), Positives = 279/347 (80%) Query: 3 YQNDDLRIKEIKELLPPVALLEKFPATENAANTVAHARKAIHKILKGNDDRLLVVIGPCS 62 + DD+RI+E+KEL PP L+ +F E ++ + ++R A+H+IL G +DRL+V+IGPCS Sbjct: 4 HNTDDVRIRELKELTPPAHLIREFACDETVSDVIYNSRTAMHRILHGMEDRLIVIIGPCS 63 Query: 63 IHDPVAAKEYATRLLALREELKDELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFQINDG 122 IHD AA EYA RL+ R+ ELEIVMRVYFEKPRTTVGWKGLINDPHMDNSF+INDG Sbjct: 64 IHDTKAAMEYAGRLIEQRKRFAGELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFKINDG 123 Query: 123 LRIARKLLLDINDSGLPAAGEFLDMITPQYLADLMSWGAIGARTTESQVHRELASGLSCP 182 LR AR+LLL IN+ GLPA E+LDMI+PQY+ADL+SWGAIGARTTESQVHRELASGLSCP Sbjct: 124 LRTARELLLRINELGLPAGTEYLDMISPQYIADLISWGAIGARTTESQVHRELASGLSCP 183 Query: 183 VGFKNGTDGTIKVAIDAINAAGAPHCFLSVTKWGHSAIVNTSGNGDCHIILRGGKEPNYS 242 VGFKNGTDG +K+A+DAI AA PH FLSVTK GHSAIV+T+GN DCHIILRGGK PNY Sbjct: 184 VGFKNGTDGNVKIAVDAIKAASQPHHFLSVTKGGHSAIVSTAGNEDCHIILRGGKTPNYD 243 Query: 243 AKHVAEVKEGLNKAGLPAQVMIDFSHANSSKQFKKQMDVCADVCQQIAGGEKAIIGVMVE 302 A V + KAGL A++MID SHANSSK+ + Q+ VCAD+ +QIA G++ I+GVMVE Sbjct: 244 ADSVNAACADIGKAGLAARLMIDASHANSSKKHENQIPVCADIGRQIASGDERIVGVMVE 303 Query: 303 SHLVEGNQSLESGEPLAYGKSITDACIGWEDTDALLRQLANAVKARR 349 SHLV G Q L+ G L YG+SITDACIGW+++ A+L LA+AVK RR Sbjct: 304 SHLVAGRQDLQEGCALTYGQSITDACIGWDESVAVLEGLADAVKQRR 350 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 466 Number of extensions: 9 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 350 Length of database: 357 Length adjustment: 29 Effective length of query: 321 Effective length of database: 328 Effective search space: 105288 Effective search space used: 105288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate BPHYT_RS03535 BPHYT_RS03535 (phospho-2-dehydro-3-deoxyheptonate aldolase)
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.31918.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-167 542.8 0.1 1.4e-167 542.6 0.1 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS03535 BPHYT_RS03535 phospho-2-dehydro- Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS03535 BPHYT_RS03535 phospho-2-dehydro-3-deoxyheptonate aldolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 542.6 0.1 1.4e-167 1.4e-167 1 342 [] 7 350 .. 7 350 .. 0.99 Alignments for each domain: == domain 1 score: 542.6 bits; conditional E-value: 1.4e-167 TIGR00034 1 ddlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakr 70 dd+ri +++el++P++l+++f+ e++ + + +sr+++++il+G +drl+v+iGPcsihd +aa+eya r lcl|FitnessBrowser__BFirm:BPHYT_RS03535 7 DDVRIRELKELTPPAHLIREFACDETVSDVIYNSRTAMHRILHGMEDRLIVIIGPCSIHDTKAAMEYAGR 76 799******************************************************************* PP TIGR00034 71 lkklaeklkddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatell 140 l + ++++ +leivmrvyfekPrttvGWkGlindP++++sf++n+Glr ar+lll ++elglp++te+l lcl|FitnessBrowser__BFirm:BPHYT_RS03535 77 LIEQRKRFAGELEIVMRVYFEKPRTTVGWKGLINDPHMDNSFKINDGLRTARELLLRINELGLPAGTEYL 146 ********************************************************************** PP TIGR00034 141 dtispqyladllswgaiGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvtka 210 d+ispqy+adl+swgaiGarttesqvhrelasgls+pvgfkngtdG++k+a+dai+aa+++h+flsvtk lcl|FitnessBrowser__BFirm:BPHYT_RS03535 147 DMISPQYIADLISWGAIGARTTESQVHRELASGLSCPVGFKNGTDGNVKIAVDAIKAASQPHHFLSVTKG 216 ********************************************************************** PP TIGR00034 211 GqvaivetkGnedghiilrGGkkpnydaedvaevkeelekaglkeelmidfshgnsnkdykrqlevaesv 280 G++aiv+t+Gned+hiilrGGk+pnyda++v+++++++ kagl ++lmid+sh+ns+k++++q+ v++++ lcl|FitnessBrowser__BFirm:BPHYT_RS03535 217 GHSAIVSTAGNEDCHIILRGGKTPNYDADSVNAACADIGKAGLAARLMIDASHANSSKKHENQIPVCADI 286 ********************************************************************** PP TIGR00034 281 veqiaeGekaiiGvmiesnleeGnqslke..elkyGksvtdacigwedteallrklaeavkerr 342 +qia+G++ i+Gvm+es+l+ G+q+l+e +l+yG+s+tdacigw+++ a+l+ la+avk+rr lcl|FitnessBrowser__BFirm:BPHYT_RS03535 287 GRQIASGDERIVGVMVESHLVAGRQDLQEgcALTYGQSITDACIGWDESVAVLEGLADAVKQRR 350 ***************************7622699***************************996 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (357 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.20 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory