GapMind for Amino acid biosynthesis

 

Aligments for a candidate for prs in Burkholderia phytofirmans PsJN

Align ribose-phosphate diphosphokinase (EC 2.7.6.1) (characterized)
to candidate BPHYT_RS02845 BPHYT_RS02845 ribose-phosphate pyrophosphokinase

Query= BRENDA::P0A717
         (315 letters)



>lcl|FitnessBrowser__BFirm:BPHYT_RS02845 BPHYT_RS02845
           ribose-phosphate pyrophosphokinase
          Length = 318

 Score =  403 bits (1036), Expect = e-117
 Identities = 195/310 (62%), Positives = 249/310 (80%), Gaps = 1/310 (0%)

Query: 4   MKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTCAPT 63
           + +F GNA P LAQ +   L   LG A V RFSDGE+ V+I ENVRG D+F++QSTCAP 
Sbjct: 7   LMVFTGNANPALAQEVVKILGIPLGKAMVSRFSDGEIQVEIQENVRGKDVFVLQSTCAPA 66

Query: 64  NDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSVGVD 123
           NDNLMEL++MVDAL+RASAGRITA IPYFGYARQDRR RSARV I+AK+VA+ L   GV+
Sbjct: 67  NDNLMELMIMVDALKRASAGRITAAIPYFGYARQDRRPRSARVAISAKIVANMLEIAGVE 126

Query: 124 RVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAIAKL 183
           R++T+DLHA+QIQGFFD+PVDN++ +P+LL D+ + N +N +VVSPD+GGVVRARA+AK 
Sbjct: 127 RIITMDLHADQIQGFFDIPVDNIYATPVLLGDLRKQNYENLLVVSPDVGGVVRARALAKQ 186

Query: 184 LNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERGAKR 243
           LN  D+AIIDKRRP+ANV++VM+IIG+V GR CV++DDM+DT GTLCKAA+ LKERGAK+
Sbjct: 187 LN-CDLAIIDKRRPKANVAEVMNIIGEVEGRTCVIMDDMVDTAGTLCKAAQVLKERGAKQ 245

Query: 244 VFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLSDEIKSLPNVRTLTLSGMLAEAIRRI 303
           VFAYATHP+ SG A   +  S +D +VV DTIPL DE +S   +R+LT +G+LAE   RI
Sbjct: 246 VFAYATHPVLSGGAGERIAASALDALVVTDTIPLGDEARSCAKIRSLTSAGLLAETFSRI 305

Query: 304 SNEESISAMF 313
              +S+ ++F
Sbjct: 306 RRGDSVMSLF 315


Lambda     K      H
   0.321    0.137    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 311
Number of extensions: 10
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 315
Length of database: 318
Length adjustment: 27
Effective length of query: 288
Effective length of database: 291
Effective search space:    83808
Effective search space used:    83808
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

Align candidate BPHYT_RS02845 BPHYT_RS02845 (ribose-phosphate pyrophosphokinase)
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01251.hmm
# target sequence database:        /tmp/gapView.14981.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01251  [M=309]
Accession:   TIGR01251
Description: ribP_PPkin: ribose-phosphate diphosphokinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                -----------
     5e-125  402.5   0.3   5.6e-125  402.3   0.3    1.0  1  lcl|FitnessBrowser__BFirm:BPHYT_RS02845  BPHYT_RS02845 ribose-phosphate p


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__BFirm:BPHYT_RS02845  BPHYT_RS02845 ribose-phosphate pyrophosphokinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  402.3   0.3  5.6e-125  5.6e-125       2     308 ..       8     315 ..       7     316 .. 0.99

  Alignments for each domain:
  == domain 1  score: 402.3 bits;  conditional E-value: 5.6e-125
                                TIGR01251   2 kilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmellll 71 
                                              +++ g+++++la++v k lg++lg++ v +F+dgE++v+i+e+vrgkdvf++ qst+ap nd+lmel+++
  lcl|FitnessBrowser__BFirm:BPHYT_RS02845   8 MVFTGNANPALAQEVVKILGIPLGKAMVSRFSDGEIQVEIQENVRGKDVFVL-QSTCAPANDNLMELMIM 76 
                                              89**************************************************.***************** PP

                                TIGR01251  72 idalkrasaksvtaviPyygYaRqdkkak.srepisaklvaklleeaGadrvltvdlHseqiqgfFdvpv 140
                                              +dalkrasa+++ta iPy+gYaRqd++ +  r +isak+va++le aG++r++t+dlH++qiqgfFd+pv
  lcl|FitnessBrowser__BFirm:BPHYT_RS02845  77 VDALKRASAGRITAAIPYFGYARQDRRPRsARVAISAKIVANMLEIAGVERIITMDLHADQIQGFFDIPV 146
                                              **************************97758*************************************** PP

                                TIGR01251 141 enlsaspklieelkkkelknlvvvsPDkGaverakkvakklglelaiieKeRdskenevevtnllgdveg 210
                                              +n++a p+l+ +l+k++ +nl+vvsPD G+v ra+++ak+l+++laii+K+R+ k+n++ev+n++g+veg
  lcl|FitnessBrowser__BFirm:BPHYT_RS02845 147 DNIYATPVLLGDLRKQNYENLLVVSPDVGGVVRARALAKQLNCDLAIIDKRRP-KANVAEVMNIIGEVEG 215
                                              *****************************************************.899************* PP

                                TIGR01251 211 kdvvivDDiisTggTlvkaaelLkekGAkkvivaathgvfsgdAlerlaeagveevivtntilv.ee.kk 278
                                              +++vi+DD+++T+gTl+kaa++Lke+GAk+v+++ath+v+sg A er+a + +++++vt+ti+  +e ++
  lcl|FitnessBrowser__BFirm:BPHYT_RS02845 216 RTCVIMDDMVDTAGTLCKAAQVLKERGAKQVFAYATHPVLSGGAGERIAASALDALVVTDTIPLgDEaRS 285
                                              ****************************************************************9888** PP

                                TIGR01251 279 lpkvseisvapliaeaiarihenesvsslf 308
                                              + k++ ++ a l+ae+ +ri+++ sv slf
  lcl|FitnessBrowser__BFirm:BPHYT_RS02845 286 CAKIRSLTSAGLLAETFSRIRRGDSVMSLF 315
                                              *****************************9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (309 nodes)
Target sequences:                          1  (318 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 8.45
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory