Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 (characterized)
to candidate BPHYT_RS12200 BPHYT_RS12200 succinyl-diaminopimelate desuccinylase
Query= SwissProt::Q9JYL2 (381 letters) >FitnessBrowser__BFirm:BPHYT_RS12200 Length = 379 Score = 470 bits (1209), Expect = e-137 Identities = 231/376 (61%), Positives = 281/376 (74%), Gaps = 4/376 (1%) Query: 6 SLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTKNIWLRR----GTKAP 61 +L L ++LI+R SVTPDD+ CQ+LL ERL +GF E + N+W + GT Sbjct: 4 TLALTEQLIARASVTPDDQHCQRLLIERLAALGFEHETIESNGVTNLWAVKRGVDGTAGK 63 Query: 62 VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAKHP 121 ++ FAGHTDVVPTGP+E+W S PFEP RDG+LYGRGAADMK SIA FV A E FVA HP Sbjct: 64 LLAFAGHTDVVPTGPLEQWRSAPFEPTHRDGKLYGRGAADMKASIAGFVVASEEFVAAHP 123 Query: 122 NHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181 H+G+IA LITSDEEG A DGT KVV+ L+ R E +DYCIVGEPT+ + GDM+KNGRRG Sbjct: 124 AHRGTIAFLITSDEEGPATDGTVKVVEALQERGERMDYCIVGEPTSSAQFGDMVKNGRRG 183 Query: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241 S+SG L VKG QGHIAYPHLA NPVH APAL EL E WD+GNEYFPPT++Q+SNI+ G Sbjct: 184 SMSGKLIVKGVQGHIAYPHLAKNPVHLLAPALAELVAERWDDGNEYFPPTTWQVSNIHSG 243 Query: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCSGQPFLTQAGK 301 TGATNVIPG +V FNFRFST ST GL+ RVHAILDKHG++YDLQW+ SG PFLT G Sbjct: 244 TGATNVIPGHADVMFNFRFSTASTVEGLQARVHAILDKHGLEYDLQWTVSGLPFLTPRGD 303 Query: 302 LTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQINENVRLNDI 361 L++ AI + G+ ELSTTGGTSDGRFI I +++IE GP NA+IH+I+E++ + I Sbjct: 304 LSNALAKAIKDETGLNTELSTTGGTSDGRFIARICKQVIEFGPLNASIHKIDEHIEVAHI 363 Query: 362 PKLSAVYEGILARLLA 377 L VY +L +L+A Sbjct: 364 EPLKNVYRRVLEQLIA 379 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 496 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 379 Length adjustment: 30 Effective length of query: 351 Effective length of database: 349 Effective search space: 122499 Effective search space used: 122499 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate BPHYT_RS12200 BPHYT_RS12200 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.24845.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-164 531.6 0.0 5.5e-164 531.5 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS12200 BPHYT_RS12200 succinyl-diaminopi Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS12200 BPHYT_RS12200 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 531.5 0.0 5.5e-164 5.5e-164 3 370 .] 6 377 .. 4 377 .. 0.98 Alignments for each domain: == domain 1 score: 531.5 bits; conditional E-value: 5.5e-164 TIGR01246 3 elakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgt....eepvlvfaGhtDvvP 68 +l+++Li r svtP+d+ +q l++erL +lgfe e++e ++++nlwa ++ + l+faGhtDvvP lcl|FitnessBrowser__BFirm:BPHYT_RS12200 6 ALTEQLIARASVTPDDQHCQRLLIERLAALGFEHETIESNGVTNLWAVKRGvdgtAGKLLAFAGHTDVVP 75 6899******************************************9765445558899*********** PP TIGR01246 69 aGelekWssdpfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGt 138 +G+le+W+s pfep++rdGklygrGaaDmk+s+a fvva+e+fv++++ h+G++++litsDeeg a dGt lcl|FitnessBrowser__BFirm:BPHYT_RS12200 76 TGPLEQWRSAPFEPTHRDGKLYGRGAADMKASIAGFVVASEEFVAAHPAHRGTIAFLITSDEEGPATDGT 145 ********************************************************************** PP TIGR01246 139 kkvvetlkerdelidyavvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvl 208 +kvve l+er e +dy++vgeP+s+ + GD++k+GrrGs++gkl +kG+qGh+aYPh+a+nPvh ++p+l lcl|FitnessBrowser__BFirm:BPHYT_RS12200 146 VKVVEALQERGERMDYCIVGEPTSSAQFGDMVKNGRRGSMSGKLIVKGVQGHIAYPHLAKNPVHLLAPAL 215 ********************************************************************** PP TIGR01246 209 keliaiklDeGneffppsslqianieagtgasnviPgelkvkfnlrfssevseeelkskvekildkhkld 278 +el+a+++D+Gne+fpp+ q++ni++gtga+nviPg+++v+fn+rfs+ +++e l+ +v++ildkh+l+ lcl|FitnessBrowser__BFirm:BPHYT_RS12200 216 AELVAERWDDGNEYFPPTTWQVSNIHSGTGATNVIPGHADVMFNFRFSTASTVEGLQARVHAILDKHGLE 285 ********************************************************************** PP TIGR01246 279 YelewklsgepfltkegklikkvaeaieevlkkkpelstsGGtsDarfiaklgaevvelGlvndtihkvn 348 Y+l+w++sg pflt +g+l +++a+ai+ ++ ++elst+GGtsD+rfia++ +v+e+G++n++ihk++ lcl|FitnessBrowser__BFirm:BPHYT_RS12200 286 YDLQWTVSGLPFLTPRGDLSNALAKAIKDETGLNTELSTTGGTSDGRFIARICKQVIEFGPLNASIHKID 355 ********************************************************************** PP TIGR01246 349 eavkiedleklsevyeklleel 370 e+++++ +e l++vy+++le+l lcl|FitnessBrowser__BFirm:BPHYT_RS12200 356 EHIEVAHIEPLKNVYRRVLEQL 377 *******************986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (379 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.67 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory