Align 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase; Tetrahydrodipicolinate N-acetyltransferase; THP acetyltransferase; Tetrahydropicolinate acetylase; EC 2.3.1.89 (characterized)
to candidate BPHYT_RS18565 BPHYT_RS18565 bifunctional protein GlmU
Query= SwissProt::O34981 (236 letters) >FitnessBrowser__BFirm:BPHYT_RS18565 Length = 453 Score = 55.1 bits (131), Expect = 2e-12 Identities = 38/117 (32%), Positives = 60/117 (51%), Gaps = 9/117 (7%) Query: 92 ARIEPGAIIRDQVEIGDNAVIMMGASINIGSVIGEGTMIDMNVVLGGRATVGKNCHIGAG 151 AR+ PGA + D+ +G N V + A + GS T I G + +G +IGAG Sbjct: 326 ARLRPGASLHDESHVG-NFVEVKNAVLGRGSKANHLTYI-------GDSDIGARVNIGAG 377 Query: 152 SVLAGVIEPPSAKPVVIEDDVVIGANAVVLEGVTVGKGAVVAAGAIVVNDVEPYTVV 208 ++ + + +IEDDV +G++ ++ V V +GA +AAG V DVE +V Sbjct: 378 TITCNY-DGANKFRTIIEDDVFVGSDTQLVAPVRVKRGATIAAGTTVWKDVEADALV 433 Score = 33.1 bits (74), Expect = 1e-05 Identities = 35/138 (25%), Positives = 57/138 (41%), Gaps = 6/138 (4%) Query: 79 NSAIPMLDLKNIKARIEPGAIIRDQVEIGDNAVIMMGASINIGSVIGEGTMIDMNVVLGG 138 NS + +L+ I A++ V + D A + + ++ G + ID+N V G Sbjct: 223 NSKQQLAELERIHQHNVADALLVAGVTLADPARLDVRGTLECGRDVS----IDVNCVFEG 278 Query: 139 RATVGKNCHIGAGSVL--AGVIEPPSAKPVVIEDDVVIGANAVVLEGVTVGKGAVVAAGA 196 R T+ N IG V+ A + + +GANAV+ + GA + + Sbjct: 279 RVTLADNVTIGPNCVIRDANIGAGTRVDAFTHIEGAEVGANAVLGPYARLRPGASLHDES 338 Query: 197 IVVNDVEPYTVVAGTPAK 214 V N VE V G +K Sbjct: 339 HVGNFVEVKNAVLGRGSK 356 Lambda K H 0.313 0.134 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 2 Length of query: 236 Length of database: 453 Length adjustment: 28 Effective length of query: 208 Effective length of database: 425 Effective search space: 88400 Effective search space used: 88400 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory