Align [amino group carrier protein]-gamma-(L-lysyl)-L-glutamate aminotransferase (EC 2.6.1.118) (characterized)
to candidate BPHYT_RS07695 BPHYT_RS07695 acetylornithine aminotransferase
Query= BRENDA::Q93R93 (395 letters) >FitnessBrowser__BFirm:BPHYT_RS07695 Length = 411 Score = 256 bits (654), Expect = 8e-73 Identities = 149/377 (39%), Positives = 210/377 (55%), Gaps = 17/377 (4%) Query: 33 RGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQTLPTPMRGEF 92 RG G+RVWD +G +YID GG V LGH +PE++ + Q L + Sbjct: 28 RGLGSRVWDTQGRDYIDFAGGIAVTALGHAHPELLNVLHEQGGKLWHIGNGYTNEPVLRL 87 Query: 93 YRTLTAILPPELNRVFPVNSGTEANEAALKFARA-----HTGRK-KFVAAMRGFSGRTMG 146 + L + + R F NSG EANEAALK AR H K + ++ + F GRT Sbjct: 88 AKRLEDLTFAD--RAFFANSGAEANEAALKLARRVAFDRHGADKYEIISFTQSFHGRTFF 145 Query: 147 SLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVILEPVQGEGGVRPATPE 206 ++SV +PKY E F P+ + +PYND+EA+K+A+ +T AVI+EP+QGEGGV PA P Sbjct: 146 TVSVGGQPKYSEGFGPVPAGITHLPYNDIEAVKKAIGAQTCAVIVEPIQGEGGVIPADPA 205 Query: 207 FLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILTLAKALGGGVPLGVAV 266 FL+A RE + GALLI DE+QTG+GR+G +A++ G+ PDILT AKALG G P+G + Sbjct: 206 FLKALREACDQHGALLIFDEVQTGVGRSGYFYAYQETGVTPDILTTAKALGNGFPIGAML 265 Query: 267 MREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAAELGPWFMEKLRAIPS 326 E+A G HGTT+GGNPL A + + +L E L + Sbjct: 266 TTNELAAYFKVGVHGTTYGGNPLGAAIAEKVVELVSDPKLLEGVRSRSEALKGHLAKLNE 325 Query: 327 --PKIREVRGMGLMVGLELKEK---AAPYIARLEKEHRVLALQAGPTVIRFLPPLVIEKE 381 EVRG GL++G EL E A +H V+ L AGP V+RF+P L++ + Sbjct: 326 RFGLFTEVRGRGLLIGAELNEAFKGRAKDFVTAAGQHGVIMLMAGPDVLRFVPSLIMPLD 385 Query: 382 DL----ERVVEAVRAVL 394 D+ ER+ +A+ +++ Sbjct: 386 DMNEGFERLAKAIESIV 402 Lambda K H 0.319 0.137 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 410 Number of extensions: 19 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 411 Length adjustment: 31 Effective length of query: 364 Effective length of database: 380 Effective search space: 138320 Effective search space used: 138320 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory