Align candidate BPHYT_RS02305 BPHYT_RS02305 (methionine synthase)
to HMM PF02965 (Met_synt_B12)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/PF02965.17.hmm # target sequence database: /tmp/gapView.16734.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: Met_synt_B12 [M=273] Accession: PF02965.17 Description: Vitamin B12 dependent methionine synthase, activation domain Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.6e-126 405.6 0.0 2e-125 403.8 0.0 1.9 2 lcl|FitnessBrowser__BFirm:BPHYT_RS02305 BPHYT_RS02305 methionine synthas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS02305 BPHYT_RS02305 methionine synthase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ? -1.9 0.0 0.1 0.1 101 149 .. 450 498 .. 369 521 .. 0.51 2 ! 403.8 0.0 2e-125 2e-125 1 271 [. 612 886 .. 612 888 .. 0.98 Alignments for each domain: == domain 1 score: -1.9 bits; conditional E-value: 0.1 Met_synt_B12 101 eeepnlcLaDfvapkesgikdyiGlFavtagigieelaekfeaekddYs 149 ++ ++ D +a+++ + +d iGl + + e ++ + e ++ddY lcl|FitnessBrowser__BFirm:BPHYT_RS02305 450 NMGVMVSCNDILAKAKVEGADIIGLSGLITPSLEEMAYVASEMQRDDYF 498 4445567777777777777888887665553333333344566667775 PP == domain 2 score: 403.8 bits; conditional E-value: 2e-125 Met_synt_B12 1 dleelveyidWtpffqawelkgkypkiledeevgeeakklfkdaqallkriieekllkakavvglfpAns 70 dl+el++yidW pffq+w+l+g yp+il+de vge+a+++f+d++++l+r+i+ ++l+a++v+ l+pAn+ lcl|FitnessBrowser__BFirm:BPHYT_RS02305 612 DLSELANYIDWGPFFQTWDLAGPYPAILNDEIVGESARRVFSDGKSMLARLIQGRWLQANGVIALLPANT 681 589******************************************************************* PP Met_synt_B12 71 eg.ddievytdesrsevlatlhtLRqqeeke....eeepnlcLaDfvapkesgikdyiGlFavtagigie 135 ++ ddie+ytdesrsev+ t++ LRqq+ + ++pn++LaDf+apk+sg++dyiG+Favtag+g++ lcl|FitnessBrowser__BFirm:BPHYT_RS02305 682 VNdDDIEIYTDESRSEVALTWRNLRQQSVRPvvdgVMRPNRSLADFIAPKDSGVADYIGMFAVTAGLGVD 751 96488**********************9999998899********************************* PP Met_synt_B12 136 elaekfeaekddYssilvkaladrLaeAfaellhekvrkelWgyakdeklsneelikekyqgirpApGYp 205 + ++fe+++ddYs+i++kaladr+aeAfae lh +vr++lWgya+ e+lsn++li+eky+girpApGYp lcl|FitnessBrowser__BFirm:BPHYT_RS02305 752 VKEKQFEKDHDDYSAIMLKALADRFAEAFAEALHARVRRDLWGYANAETLSNDDLIAEKYHGIRPAPGYP 821 ********************************************************************** PP Met_synt_B12 206 acpdhtekktlfelldaeekigieLteslamvPaasvsGlyfahpearYfavgkigkdqvedyakr 271 acpdh +k+++f++l+a+e ig+++teslam+PaasvsG+y+ahp+++Yf+vgkig+dq+edyakr lcl|FitnessBrowser__BFirm:BPHYT_RS02305 822 ACPDHLVKRDMFDVLHATE-IGMSVTESLAMLPAASVSGFYLAHPDSTYFSVGKIGQDQLEDYAKR 886 *******************.*********************************************9 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (273 nodes) Target sequences: 1 (902 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 14.09 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory