Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate BPHYT_RS01595 BPHYT_RS01595 homoserine O-acetyltransferase
Query= SwissProt::Q12XS2 (488 letters) >lcl|FitnessBrowser__BFirm:BPHYT_RS01595 BPHYT_RS01595 homoserine O-acetyltransferase Length = 381 Score = 360 bits (924), Expect = e-104 Identities = 179/369 (48%), Positives = 243/369 (65%), Gaps = 7/369 (1%) Query: 5 SVGIVATNYHTIEGEFQLEGGHTLKNIRLAYETYGNLNKEKSNAILVCHALTGDAHAAGR 64 S+GIVA + QL+ G +L L ETYG LN +SNA+LVCHAL H AG Sbjct: 3 SIGIVAPHKMHFTEPLQLQNGSSLAGYDLMVETYGTLNAARSNAVLVCHALNASHHVAGV 62 Query: 65 HSDDDKKPGWWDDIIGPGKALDTDRYFVLCSNVLGGCKGTTGPASLDPDTGRQYGITFPV 124 ++D+ K GWWD+++GPGK LDTD++FV+ N LG C G+TGP S+DP TG YG FPV Sbjct: 63 YADNPKDIGWWDNMVGPGKPLDTDKFFVIGVNNLGSCFGSTGPMSIDPATGNPYGAAFPV 122 Query: 125 ITIRDMVNVQKRLIDHMGITTLFAVVGGSMGGMQTLQWCVAYPELVKKAVVIASTAVSSP 184 +T+ D VN Q R+ D GIT AV+GGS+GGMQ L W + YPE V +V+AST S Sbjct: 123 VTVEDWVNAQARVADQFGITRFAAVMGGSLGGMQALAWSMMYPERVGHCIVVASTPKLSA 182 Query: 185 QQIAFNEVGRNAIISDPDWNGGDYY-EGEPPVNGLSTARMIAHITYLSDASMHEKFGRRL 243 Q IAFNEV R+AI+SDPD++GG+YY P GL ARMI HITYLSD M EKFGR L Sbjct: 183 QNIAFNEVARSAILSDPDFHGGNYYAHNVKPKRGLRVARMIGHITYLSDDDMAEKFGRSL 242 Query: 244 QQGE----SYKFDMSNDFQVGSYLKYQGDTFTGRFDANSYLYATKAVDYFD--LSMNGSL 297 ++ E +Y F+ +F+V SYL+YQGD F FDAN+YL T+A+DYFD + +G L Sbjct: 243 RRAEGAVDAYNFNFDVEFEVESYLRYQGDKFADYFDANTYLLITRALDYFDPAKAFDGDL 302 Query: 298 AEGLKYVQAKMLVISITSDWLYSPYHSKKIVEGLTVKEHDVSYREIESSYGHDAFLLESG 357 + + AK L+ S ++DW ++P S+++V+ L + V+Y EI++ +GHDAFLL+ Sbjct: 303 TAAVAHTTAKYLIASFSTDWRFAPARSRELVKALLDHKRTVTYAEIDAPHGHDAFLLDDA 362 Query: 358 QINYVIHNF 366 + + ++ + Sbjct: 363 RYHNLMRAY 371 Lambda K H 0.318 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 528 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 488 Length of database: 381 Length adjustment: 32 Effective length of query: 456 Effective length of database: 349 Effective search space: 159144 Effective search space used: 159144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate BPHYT_RS01595 BPHYT_RS01595 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.2434.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-143 463.0 0.1 3.5e-143 462.8 0.1 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS01595 BPHYT_RS01595 homoserine O-acety Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS01595 BPHYT_RS01595 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 462.8 0.1 3.5e-143 3.5e-143 2 349 .. 15 371 .. 14 373 .. 0.96 Alignments for each domain: == domain 1 score: 462.8 bits; conditional E-value: 3.5e-143 TIGR01392 2 eeeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk..GWWdellGpgrald 69 +e+l+l++G+ l ++++++tyGtlna+r+NavlvcHal +s+hvag + ++ k GWWd+++Gpg++ld lcl|FitnessBrowser__BFirm:BPHYT_RS01595 15 TEPLQLQNGSSLAGYDLMVETYGTLNAARSNAVLVCHALNASHHVAGVYADNPKdiGWWDNMVGPGKPLD 84 579**********************************************9888899************** PP TIGR01392 70 tsryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGG 139 t+++fv+++N+lGsc GstgP+si+p+tg+pyga fP+vt++D+v+aq++++d++g++++aav+GgSlGG lcl|FitnessBrowser__BFirm:BPHYT_RS01595 85 TDKFFVIGVNNLGSCFGSTGPMSIDPATGNPYGAAFPVVTVEDWVNAQARVADQFGITRFAAVMGGSLGG 154 ********************************************************************** PP TIGR01392 140 mqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARmla 208 mqal w+++yperv +++v+a+++++saq+iafnev+r ailsDp++++G+y+ ++ +P++GL++ARm++ lcl|FitnessBrowser__BFirm:BPHYT_RS01595 155 MQALAWSMMYPERVGHCIVVASTPKLSAQNIAFNEVARSAILSDPDFHGGNYYAHNvKPKRGLRVARMIG 224 *******************************************************99************* PP TIGR01392 209 lltYrseesleerfgreaksee....slassleeefsvesylryqgkkfverFdAnsYllltkaldthdl 274 ++tY+s+++++e+fgr+ +++e +++++++ ef+vesylryqg+kf++ FdAn+Yll+t+ald++d lcl|FitnessBrowser__BFirm:BPHYT_RS01595 225 HITYLSDDDMAEKFGRSLRRAEgavdAYNFNFDVEFEVESYLRYQGDKFADYFDANTYLLITRALDYFDP 294 *****************999984444444556************************************** PP TIGR01392 275 argrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekekv 342 a+ +++l++a+++++a++l++++++D++f++++++el+kal + k + yaei+ ++GHDaFll+++++ lcl|FitnessBrowser__BFirm:BPHYT_RS01595 295 AKAFDGDLTAAVAHTTAKYLIASFSTDWRFAPARSRELVKALLDHKRTvtYAEIDAPHGHDAFLLDDARY 364 ******************************************98888778******************** PP TIGR01392 343 eeliref 349 ++l+r++ lcl|FitnessBrowser__BFirm:BPHYT_RS01595 365 HNLMRAY 371 *999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (381 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.27 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory