Align Homoserine O-acetyltransferase; HAT; Homoserine transacetylase; HTA; EC 2.3.1.31 (characterized)
to candidate BPHYT_RS01595 BPHYT_RS01595 homoserine O-acetyltransferase
Query= SwissProt::Q12XS2 (488 letters) >FitnessBrowser__BFirm:BPHYT_RS01595 Length = 381 Score = 360 bits (924), Expect = e-104 Identities = 179/369 (48%), Positives = 243/369 (65%), Gaps = 7/369 (1%) Query: 5 SVGIVATNYHTIEGEFQLEGGHTLKNIRLAYETYGNLNKEKSNAILVCHALTGDAHAAGR 64 S+GIVA + QL+ G +L L ETYG LN +SNA+LVCHAL H AG Sbjct: 3 SIGIVAPHKMHFTEPLQLQNGSSLAGYDLMVETYGTLNAARSNAVLVCHALNASHHVAGV 62 Query: 65 HSDDDKKPGWWDDIIGPGKALDTDRYFVLCSNVLGGCKGTTGPASLDPDTGRQYGITFPV 124 ++D+ K GWWD+++GPGK LDTD++FV+ N LG C G+TGP S+DP TG YG FPV Sbjct: 63 YADNPKDIGWWDNMVGPGKPLDTDKFFVIGVNNLGSCFGSTGPMSIDPATGNPYGAAFPV 122 Query: 125 ITIRDMVNVQKRLIDHMGITTLFAVVGGSMGGMQTLQWCVAYPELVKKAVVIASTAVSSP 184 +T+ D VN Q R+ D GIT AV+GGS+GGMQ L W + YPE V +V+AST S Sbjct: 123 VTVEDWVNAQARVADQFGITRFAAVMGGSLGGMQALAWSMMYPERVGHCIVVASTPKLSA 182 Query: 185 QQIAFNEVGRNAIISDPDWNGGDYY-EGEPPVNGLSTARMIAHITYLSDASMHEKFGRRL 243 Q IAFNEV R+AI+SDPD++GG+YY P GL ARMI HITYLSD M EKFGR L Sbjct: 183 QNIAFNEVARSAILSDPDFHGGNYYAHNVKPKRGLRVARMIGHITYLSDDDMAEKFGRSL 242 Query: 244 QQGE----SYKFDMSNDFQVGSYLKYQGDTFTGRFDANSYLYATKAVDYFD--LSMNGSL 297 ++ E +Y F+ +F+V SYL+YQGD F FDAN+YL T+A+DYFD + +G L Sbjct: 243 RRAEGAVDAYNFNFDVEFEVESYLRYQGDKFADYFDANTYLLITRALDYFDPAKAFDGDL 302 Query: 298 AEGLKYVQAKMLVISITSDWLYSPYHSKKIVEGLTVKEHDVSYREIESSYGHDAFLLESG 357 + + AK L+ S ++DW ++P S+++V+ L + V+Y EI++ +GHDAFLL+ Sbjct: 303 TAAVAHTTAKYLIASFSTDWRFAPARSRELVKALLDHKRTVTYAEIDAPHGHDAFLLDDA 362 Query: 358 QINYVIHNF 366 + + ++ + Sbjct: 363 RYHNLMRAY 371 Lambda K H 0.318 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 528 Number of extensions: 28 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 488 Length of database: 381 Length adjustment: 32 Effective length of query: 456 Effective length of database: 349 Effective search space: 159144 Effective search space used: 159144 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
Align candidate BPHYT_RS01595 BPHYT_RS01595 (homoserine O-acetyltransferase)
to HMM TIGR01392 (metX: homoserine O-acetyltransferase (EC 2.3.1.31))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01392.hmm # target sequence database: /tmp/gapView.28610.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01392 [M=351] Accession: TIGR01392 Description: homoserO_Ac_trn: homoserine O-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.1e-143 463.0 0.1 3.5e-143 462.8 0.1 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS01595 BPHYT_RS01595 homoserine O-acety Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS01595 BPHYT_RS01595 homoserine O-acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 462.8 0.1 3.5e-143 3.5e-143 2 349 .. 15 371 .. 14 373 .. 0.96 Alignments for each domain: == domain 1 score: 462.8 bits; conditional E-value: 3.5e-143 TIGR01392 2 eeeltlesGevlsevevayktyGtlnaerdNavlvcHaltgsahvagkadeedk..GWWdellGpgrald 69 +e+l+l++G+ l ++++++tyGtlna+r+NavlvcHal +s+hvag + ++ k GWWd+++Gpg++ld lcl|FitnessBrowser__BFirm:BPHYT_RS01595 15 TEPLQLQNGSSLAGYDLMVETYGTLNAARSNAVLVCHALNASHHVAGVYADNPKdiGWWDNMVGPGKPLD 84 579**********************************************9888899************** PP TIGR01392 70 tsryfvvclNvlGsckGstgPlsinpetgkpygaefPlvtirDlvkaqkalldsLgveklaavvGgSlGG 139 t+++fv+++N+lGsc GstgP+si+p+tg+pyga fP+vt++D+v+aq++++d++g++++aav+GgSlGG lcl|FitnessBrowser__BFirm:BPHYT_RS01595 85 TDKFFVIGVNNLGSCFGSTGPMSIDPATGNPYGAAFPVVTVEDWVNAQARVADQFGITRFAAVMGGSLGG 154 ********************************************************************** PP TIGR01392 140 mqalewalsypervkkivvlatsarasaqaiafnevqrqailsDpeyndGeyaeee.qPekGLalARmla 208 mqal w+++yperv +++v+a+++++saq+iafnev+r ailsDp++++G+y+ ++ +P++GL++ARm++ lcl|FitnessBrowser__BFirm:BPHYT_RS01595 155 MQALAWSMMYPERVGHCIVVASTPKLSAQNIAFNEVARSAILSDPDFHGGNYYAHNvKPKRGLRVARMIG 224 *******************************************************99************* PP TIGR01392 209 lltYrseesleerfgreaksee....slassleeefsvesylryqgkkfverFdAnsYllltkaldthdl 274 ++tY+s+++++e+fgr+ +++e +++++++ ef+vesylryqg+kf++ FdAn+Yll+t+ald++d lcl|FitnessBrowser__BFirm:BPHYT_RS01595 225 HITYLSDDDMAEKFGRSLRRAEgavdAYNFNFDVEFEVESYLRYQGDKFADYFDANTYLLITRALDYFDP 294 *****************999984444444556************************************** PP TIGR01392 275 argrrdslkealkkikapvlvvgiesDllftleeqeelakalkaakle..yaeieseeGHDaFllekekv 342 a+ +++l++a+++++a++l++++++D++f++++++el+kal + k + yaei+ ++GHDaFll+++++ lcl|FitnessBrowser__BFirm:BPHYT_RS01595 295 AKAFDGDLTAAVAHTTAKYLIASFSTDWRFAPARSRELVKALLDHKRTvtYAEIDAPHGHDAFLLDDARY 364 ******************************************98888778******************** PP TIGR01392 343 eeliref 349 ++l+r++ lcl|FitnessBrowser__BFirm:BPHYT_RS01595 365 HNLMRAY 371 *999886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (351 nodes) Target sequences: 1 (381 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.84 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory