Align amino-acid acetyltransferase (characterized)
to candidate BPHYT_RS12985 BPHYT_RS12985 amino acid acetyltransferase
Query= CharProtDB::CH_024150 (443 letters) >FitnessBrowser__BFirm:BPHYT_RS12985 Length = 462 Score = 399 bits (1026), Expect = e-116 Identities = 201/438 (45%), Positives = 296/438 (67%), Gaps = 7/438 (1%) Query: 8 ELVEGFRHSVPYINTHRGKTFVIMLGGEAIEHENFSSIVNDIGLLHSLGIRLVVVYGARP 67 + V+ R PYI+ R KTFV+ GGE + +++V+DI LL ++GI++V+V+G+RP Sbjct: 29 QFVDWMRSVAPYIHAFRNKTFVVGFGGEVVHQGLLNALVSDIALLQAMGIQIVLVHGSRP 88 Query: 68 QIDANLAAHHHEPLYHKNIRVTDAKTLELVKQAAGTLQLDITARLSMSLNNTPLQGAHIN 127 Q++ ++ H E + +R+TDA+ LE K+AAG ++LDI A +S L NTP+ AHI+ Sbjct: 89 QVEEQMSLHGVESEFSHGMRITDARALESAKEAAGEVRLDIEAAISQGLPNTPMAHAHIS 148 Query: 128 VVSGNFIIAQPLGVDDGVDYCHSGRIRRIDEDAIHRQLDSGAIVLMGPVAVSVTGESFNL 187 VVSGNF+ A+P+G+ DGVD+ H+G +R+ID D+I L S +VL+ P+ S TGE+FNL Sbjct: 149 VVSGNFVTARPVGILDGVDFAHTGVVRKIDADSIRHSLASRKLVLLSPLGFSPTGEAFNL 208 Query: 188 TSEEIATQLAIKLKAEKMIGFCSSQGV--TNDDGDI-VSELFPNEAQARVEAQEEKGDYN 244 E++A+ AI L+A+K++ + G+ ++G + V EL ++A E+ E GD Sbjct: 209 AMEDVASAAAIALRADKIVFLTETPGLMEAGEEGPVLVRELSLDDAYKLHESGEVTGDAG 268 Query: 245 SGTVRFLRGAVKACRSGVRRCHLISYQEDGALLQELFSRDGIGTQIVMESAEQIRRATIN 304 +L+ +++ACR GV R H+I Y DG+LL ELF DG+GT I E+ E +R AT + Sbjct: 269 F----YLKHSIRACRGGVARAHIIPYALDGSLLLELFLHDGVGTMISYENLESLREATPD 324 Query: 305 DIGGILELIRPLEQQGILVRRSREQLEMEIDKFTIIQRDNTTIACAALYPFPEEKIGEMA 364 D+GGIL LI PLE G LVRR R Q+E +ID F++I+ D CAALYP+ +E+IGEMA Sbjct: 325 DVGGILALIEPLESDGTLVRRGRHQIERDIDHFSVIEHDGVLFGCAALYPYTQERIGEMA 384 Query: 365 CVAVHPDYRSSSRGEVLLERIAAQAKQSGLSKLFVLTTRSIHWFQERGFTPVDIDLLPES 424 C+ V P+ + + GE LL+RI +A+ GL+++FVLTTR+ HWF +RGF V +D LPE Sbjct: 385 CLTVAPEAQGTGDGERLLKRIEQRARARGLTRIFVLTTRTEHWFLKRGFVKVTVDDLPED 444 Query: 425 KKQLYNYQRKSKVLMADL 442 +++LYN+QRKS VLM L Sbjct: 445 RRRLYNWQRKSLVLMKQL 462 Lambda K H 0.319 0.136 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 498 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 443 Length of database: 462 Length adjustment: 33 Effective length of query: 410 Effective length of database: 429 Effective search space: 175890 Effective search space used: 175890 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
Align candidate BPHYT_RS12985 BPHYT_RS12985 (amino acid acetyltransferase)
to HMM TIGR01890 (argA: amino-acid N-acetyltransferase (EC 2.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01890.hmm # target sequence database: /tmp/gapView.4765.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01890 [M=429] Accession: TIGR01890 Description: N-Ac-Glu-synth: amino-acid N-acetyltransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.1e-197 642.2 0.1 2.4e-197 642.0 0.1 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS12985 BPHYT_RS12985 amino acid acetylt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS12985 BPHYT_RS12985 amino acid acetyltransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 642.0 0.1 2.4e-197 2.4e-197 1 429 [] 30 462 .] 30 462 .] 0.97 Alignments for each domain: == domain 1 score: 642.0 bits; conditional E-value: 2.4e-197 TIGR01890 1 fvkwlreaaPyinahrdktlvvglggelvedknlgklvadiallhslGvrlvlvhGarpqieerlakrgr 70 fv+w+r++aPyi+a+r+kt+vvg+gge+v+++ l++lv+diall+++G+++vlvhG+rpq+ee++ +g+ lcl|FitnessBrowser__BFirm:BPHYT_RS12985 30 FVDWMRSVAPYIHAFRNKTFVVGFGGEVVHQGLLNALVSDIALLQAMGIQIVLVHGSRPQVEEQMSLHGV 99 8********************************************************************* PP TIGR01890 71 tthyvrGlrvtdeaslelvkeaaGelrlaiearlsmslantpmagsrlsvvsGnfvtarPiGvveGvdye 140 ++++ +G+r+td+ +le++keaaGe+rl+iea++s+ l+ntpma +++svvsGnfvtarP+G+++Gvd+ lcl|FitnessBrowser__BFirm:BPHYT_RS12985 100 ESEFSHGMRITDARALESAKEAAGEVRLDIEAAISQGLPNTPMAHAHISVVSGNFVTARPVGILDGVDFA 169 ********************************************************************** PP TIGR01890 141 htGevrkidaegirrlldersivllsPlgfsvtGeifnlamedvatsvaiklkadklillteedGilda. 209 htG+vrkida++ir++l +r++vllsPlgfs+tGe+fnlamedva+ +ai+l+adk+++lte++G+++a lcl|FitnessBrowser__BFirm:BPHYT_RS12985 170 HTGVVRKIDADSIRHSLASRKLVLLSPLGFSPTGEAFNLAMEDVASAAAIALRADKIVFLTETPGLMEAg 239 *******************************************************************973 PP TIGR01890 210 .dG.klvaelsaqeveslverleeet.tarllsaavkalrgGvarshlvsyaedGallqelftrdGiGtl 276 +G lv+els +++ +l e+ e +l++ ++a+rgGvar+h+++ya dG+ll+elf++dG+Gt+ lcl|FitnessBrowser__BFirm:BPHYT_RS12985 240 eEGpVLVRELSLDDAYKLHESGEVTGdAGFYLKHSIRACRGGVARAHIIPYALDGSLLLELFLHDGVGTM 309 24534899***9999998887554333689**************************************** PP TIGR01890 277 vskealesireatiddvggilelirPleeqGilvrrsrellereieefsviekdGliigcaalypyaeee 346 +s e+les+reat ddvggil+li+Ple +G+lvrr r+++er+i++fsvie+dG+++gcaalypy++e+ lcl|FitnessBrowser__BFirm:BPHYT_RS12985 310 ISYENLESLREATPDDVGGILALIEPLESDGTLVRRGRHQIERDIDHFSVIEHDGVLFGCAALYPYTQER 379 ********************************************************************** PP TIGR01890 347 vgelaclavsPeardggrGerllkhiedrarqvGlkrlfvlttrtehWfrerGfaeasvdelPearrkly 416 +ge+acl+v+Pea+++g+Gerllk+ie+rar+ Gl r+fvlttrtehWf++rGf++++vd+lPe+rr+ly lcl|FitnessBrowser__BFirm:BPHYT_RS12985 380 IGEMACLTVAPEAQGTGDGERLLKRIEQRARARGLTRIFVLTTRTEHWFLKRGFVKVTVDDLPEDRRRLY 449 ********************************************************************** PP TIGR01890 417 nyqrrskilvkkl 429 n+qr+s +l+k+l lcl|FitnessBrowser__BFirm:BPHYT_RS12985 450 NWQRKSLVLMKQL 462 ***********98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (429 nodes) Target sequences: 1 (462 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.36 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory