Align N-acetylglutamylphosphate reductase (EC 1.2.1.38) (characterized)
to candidate BPHYT_RS18340 BPHYT_RS18340 n-acetyl-gamma-glutamyl-phosphate reductase
Query= reanno::Korea:Ga0059261_0351 (310 letters) >FitnessBrowser__BFirm:BPHYT_RS18340 Length = 315 Score = 243 bits (620), Expect = 4e-69 Identities = 131/315 (41%), Positives = 185/315 (58%), Gaps = 9/315 (2%) Query: 1 MSVSVFIDGAAGTTGLEIRERLATRSDISLIGLDDAHRKDAGKRAEAINSADFVILCLPD 60 MS VF+DG GTTGL+I E L+ R+D+ ++ +++A RKD +R IN++D LCLPD Sbjct: 1 MSTKVFVDGQEGTTGLKIFEYLSQRADVEILRIEEAKRKDLEERRRLINASDVTFLCLPD 60 Query: 61 DAAREAVALIANDTTRVIDASTAHRVADGWTYGFAELEPAQAAAIAEARYVSNPGCWPTG 120 A+RE+ +L+AND T +IDASTA R + W YG EL +Q + A+ ++ PGC + Sbjct: 61 VASRESASLVANDRTVLIDASTAFRTSADWAYGLPELARSQRERLRTAKRIAVPGCHASA 120 Query: 121 FLALVRPLVRAGLIPPDWVLTAGGASGYSGGGKSMIAEFEDGSEP--TGFRAYGLDLEHK 178 F+ +RPLV AG++ P++ A +GYSGGGK MIA++E G R Y L L HK Sbjct: 121 FVLAMRPLVEAGVVTPEFAAHAYSITGYSGGGKKMIADYEAGGNDKLKSPRPYALGLTHK 180 Query: 179 HLPEMQKHARIDHAPIFQPAVARSYRGMLIEVPLPLQMLPRKPAPAQIEQVLADAYRDSP 238 HLPEM H + APIF P V Y+G+ + L +K P ++ + A+ Y Sbjct: 181 HLPEMAAHTGLKSAPIFTPIVGDFYKGLAVTTFFSPNQLAKKATPQDVQALFAEYYAGEA 240 Query: 239 IVRVLPSD-----DVSLVRIEDDAGTDRLTIRVFGNAERGQARLVATLDNLGKGAGGAAV 293 V V P D D ++ + T+R+ + VFGN ER VA LDNLGKGA GAA+ Sbjct: 241 FVNVAPFDAEANLDSGFFDVQANNDTNRVDLFVFGNEERFVT--VARLDNLGKGASGAAI 298 Query: 294 QNLNIMAGFDQTAGL 308 Q +N+ G + +GL Sbjct: 299 QCMNLAIGAAEESGL 313 Lambda K H 0.319 0.136 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 310 Length of database: 315 Length adjustment: 27 Effective length of query: 283 Effective length of database: 288 Effective search space: 81504 Effective search space used: 81504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate BPHYT_RS18340 BPHYT_RS18340 (n-acetyl-gamma-glutamyl-phosphate reductase)
to HMM TIGR01851 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01851.hmm # target sequence database: /tmp/gapView.16428.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01851 [M=310] Accession: TIGR01851 Description: argC_other: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-133 431.3 0.0 1.3e-133 431.1 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS18340 BPHYT_RS18340 n-acetyl-gamma-glu Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS18340 BPHYT_RS18340 n-acetyl-gamma-glutamyl-phosphate reductase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 431.1 0.0 1.3e-133 1.3e-133 2 309 .. 3 306 .. 2 307 .. 0.99 Alignments for each domain: == domain 1 score: 431.1 bits; conditional E-value: 1.3e-133 TIGR01851 2 pkvfidGeaGttGlqirerlaerddlellsidedkrkdaderakllnaadvailclpddaareavslvdn 71 kvf+dG++GttGl+i e+l++r d+e+l+i+e krkd +er +l+na+dv++lclpd+a+re+ slv n lcl|FitnessBrowser__BFirm:BPHYT_RS18340 3 TKVFVDGQEGTTGLKIFEYLSQRADVEILRIEEAKRKDLEERRRLINASDVTFLCLPDVASRESASLVAN 72 69******************************************************************** PP TIGR01851 72 pntkildastayrtaedwvyGfpelaaeqrekianakrvanPGcyatgaiallrPlveaGilPadfPvti 141 +t+++dasta+rt+ dw+yG+pela qre+++ akr+a+PGc+a+++++ +rPlveaG++ +f ++ lcl|FitnessBrowser__BFirm:BPHYT_RS18340 73 DRTVLIDASTAFRTSADWAYGLPELARSQRERLRTAKRIAVPGCHASAFVLAMRPLVEAGVVTPEFAAHA 142 ********************************************************************** PP TIGR01851 142 navsGysGGGkaliakyeeesaddskkaafiiyglalehkhlpemrkhsglaskPiftPavGdfaqGllv 211 +++GysGGGk++ia+ye + ++ k +++++y+l l+hkhlpem h+gl s PiftP vGdf +Gl+v lcl|FitnessBrowser__BFirm:BPHYT_RS18340 143 YSITGYSGGGKKMIADYE--AGGNDKLKSPRPYALGLTHKHLPEMAAHTGLKSAPIFTPIVGDFYKGLAV 210 ******************..7778889******************************************* PP TIGR01851 212 eiplhlaeldskvsaedihkalaeyykGekfvkvaelddaellddtildaqglngtnrlelfvfgsddge 281 + + +++l++k++++d+++ +aeyy+Ge+fv+va++d + ld++++d+q+ n+tnr++lfvfg++ e lcl|FitnessBrowser__BFirm:BPHYT_RS18340 211 TTFFSPNQLAKKATPQDVQALFAEYYAGEAFVNVAPFDAEANLDSGFFDVQANNDTNRVDLFVFGNE--E 278 ******************************************************************9..9 PP TIGR01851 282 rallvarldnlGkGasGaavqnlnialG 309 r + varldnlGkGasGaa+q++n+a+G lcl|FitnessBrowser__BFirm:BPHYT_RS18340 279 RFVTVARLDNLGKGASGAAIQCMNLAIG 306 *************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (310 nodes) Target sequences: 1 (315 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.54 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory