GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argE in Burkholderia phytofirmans PsJN

Align Acetylornithine deacetylase; AO; Acetylornithinase; EC 3.5.1.16; N-acetylornithinase; NAO (uncharacterized)
to candidate BPHYT_RS09285 BPHYT_RS09285 acetylornithine deacetylase

Query= curated2:O68873
         (380 letters)



>FitnessBrowser__BFirm:BPHYT_RS09285
          Length = 404

 Score =  180 bits (456), Expect = 7e-50
 Identities = 123/377 (32%), Positives = 189/377 (50%), Gaps = 18/377 (4%)

Query: 12  LTELVAMDTTSFRPNVPLIDYAQARLEAAGFSAERQKFLDDAGVEKVNLVAVKGGSGSGR 71
           +T LV+MDT S  PN+ LI+  +  L A G  A      D++G        +   +G   
Sbjct: 21  VTRLVSMDTVSRNPNLGLIETVRDELRAVGVEATLTH--DESGKWANLFATIPAHNGETN 78

Query: 72  AALALVGHSDCVPYDAA-W-TDALRLTEKDGRLYARGACDTKGFIACALHAA--LNAEQL 127
             + L GH+D VP D   W +D  +   +  +LY RG CD KGFI  AL     +   +L
Sbjct: 79  GGVVLSGHTDVVPVDGQQWDSDPFKPEIRGDKLYGRGTCDMKGFIGAALTLVPEMQRTKL 138

Query: 128 KAPLMVVLTADEEVGLTGAKKLVEAGLGRARH---AIVGEPTRLIPVRANKGYCLAEVEV 184
             P+   L+ DEEVG  GA  L+   + R       IVGEPT + P+ A+KG    +  V
Sbjct: 139 AKPIHFALSFDEEVGCAGAPLLIADLMKRGVKPDGCIVGEPTSMRPIVAHKGINAYQCCV 198

Query: 185 RGKEGHSAYPDSGASAIFRAGRFLQRLEHLALTVLRED--LDEGFQPPFTTVNVGVIQGG 242
           RG+  HS+    G +AI  A R +  +  +A    RE    DE +  PFTT     I GG
Sbjct: 199 RGQAAHSSLTPKGLNAIEYAARLICYIRDMA-DQFREQGPFDELYDVPFTTAQTSTIVGG 257

Query: 243 KAKNVIPGACRFVVEWRPIPGQPPE----RVSQLL-ETIRQELVRDEPAFEAQIRVVRTD 297
            A N +P  C+F  E+R +P   PE    R+ Q   ET+  +++R+ P+   +I  +   
Sbjct: 258 NAINTVPAECKFQFEFRNLPTLDPEPIFARIDQYARETLLPKMLREHPSAAIEITKIAAA 317

Query: 298 RGVNTRADAEVVRFLAEASGNAPET-VSFGTEAPQMTELGAEAVVFGPGDIRVAHQTGEY 356
            G+++   A + + +   + +  +  V++GTEA   +  G  ++V GPGDI+ AH+  E+
Sbjct: 318 PGLDSSEQAAITQLVRALTADQDKRKVAYGTEAGLFSLAGIPSIVCGPGDIQQAHKPNEF 377

Query: 357 VPVEDLVRCEAVLARAV 373
           V ++ LV CE  L + +
Sbjct: 378 VALDQLVACERFLQKFI 394


Lambda     K      H
   0.319    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 356
Number of extensions: 17
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 380
Length of database: 404
Length adjustment: 31
Effective length of query: 349
Effective length of database: 373
Effective search space:   130177
Effective search space used:   130177
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate BPHYT_RS09285 BPHYT_RS09285 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))

Software error:

../bin/blast/fastacmd -i /tmp/list.4244.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.4244.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.