Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate BPHYT_RS09285 BPHYT_RS09285 acetylornithine deacetylase
Query= BRENDA::Q92Y75 (374 letters) >FitnessBrowser__BFirm:BPHYT_RS09285 Length = 404 Score = 267 bits (682), Expect = 4e-76 Identities = 145/370 (39%), Positives = 213/370 (57%), Gaps = 13/370 (3%) Query: 9 KLVGFRSVVGLPNNDVVSWIRGYLESHGIAVDVLPGPEGDRSNIFATIGPKEAR---GYI 65 +LV +V PN ++ +R L + G+ + G +N+FATI G + Sbjct: 23 RLVSMDTVSRNPNLGLIETVRDELRAVGVEATLTHDESGKWANLFATIPAHNGETNGGVV 82 Query: 66 ISGHMDVVPAAETGWTSDPFRLRVEADRLYGRGTTDMKGFLAAVLAAVPKLAAMPLRRPL 125 +SGH DVVP W SDPF+ + D+LYGRGT DMKGF+ A L VP++ L +P+ Sbjct: 83 LSGHTDVVPVDGQQWDSDPFKPEIRGDKLYGRGTCDMKGFIGAALTLVPEMQRTKLAKPI 142 Query: 126 HLALSYDEEAGCRGVPHMIARLPELCRQPLGAIIGEPTGMRAIRAHKGKAAARLTVRGRS 185 H ALS+DEE GC G P +IA L + +P G I+GEPT MR I AHKG A + VRG++ Sbjct: 143 HFALSFDEEVGCAGAPLLIADLMKRGVKPDGCIVGEPTSMRPIVAHKGINAYQCCVRGQA 202 Query: 186 GHSSRPDQGLNAIHGVAGVLTQAVAEADRL-VGGPFEHVFEPPYSSLQIGTVKGGQAVNI 244 HSS +GLNAI A ++ AD+ GPF+ +++ P+++ Q T+ GG A+N Sbjct: 203 AHSSLTPKGLNAIEYAARLICYIRDMADQFREQGPFDELYDVPFTTAQTSTIVGGNAINT 262 Query: 245 IPDSCEVEFEARAISGVDPAELLAPVRKTAEALTTL--------GFEVEWQELSAYPALS 296 +P C+ +FE R + +DP + A + + A T L +E +++A P L Sbjct: 263 VPAECKFQFEFRNLPTLDPEPIFARIDQYARE-TLLPKMLREHPSAAIEITKIAAAPGLD 321 Query: 297 LEPDAPLAALLEELTGREALPAVSYGTEAGLFQRAGIDAIICGPGDIGRAHKPDEYILID 356 A + L+ LT + V+YGTEAGLF AGI +I+CGPGDI +AHKP+E++ +D Sbjct: 322 SSEQAAITQLVRALTADQDKRKVAYGTEAGLFSLAGIPSIVCGPGDIQQAHKPNEFVALD 381 Query: 357 ELMACRAMVE 366 +L+AC ++ Sbjct: 382 QLVACERFLQ 391 Lambda K H 0.319 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 374 Length of database: 404 Length adjustment: 30 Effective length of query: 344 Effective length of database: 374 Effective search space: 128656 Effective search space used: 128656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate BPHYT_RS09285 BPHYT_RS09285 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.18126.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-115 372.5 0.0 1.3e-115 372.2 0.0 1.0 1 lcl|FitnessBrowser__BFirm:BPHYT_RS09285 BPHYT_RS09285 acetylornithine de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__BFirm:BPHYT_RS09285 BPHYT_RS09285 acetylornithine deacetylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 372.2 0.0 1.3e-115 1.3e-115 4 364 .. 22 393 .. 20 394 .. 0.96 Alignments for each domain: == domain 1 score: 372.2 bits; conditional E-value: 1.3e-115 TIGR01892 4 akLvafdsvsarsnvdlieyvedyleelgvavevlpvadgaeksnllaviGpkeg..agglvlsGhtDvv 71 ++Lv++d+vs+ +n+ lie v+d l+++gv++ g + nl+a+i +++g +gg+vlsGhtDvv lcl|FitnessBrowser__BFirm:BPHYT_RS09285 22 TRLVSMDTVSRNPNLGLIETVRDELRAVGVEATLTHDESG-KWANLFATIPAHNGetNGGVVLSGHTDVV 90 78******************************99988888.99*******988652269*********** PP TIGR01892 72 PvdeaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGakkl 141 Pvd+++W sDpf+ + ++LYgrGt+DmkGF+ ++L vp+++ +kL kP+h +ls+Deevg+aGa+ l lcl|FitnessBrowser__BFirm:BPHYT_RS09285 91 PVDGQQWDSDPFKPEIRGDKLYGRGTCDMKGFIGAALTLVPEMQRTKLAKPIHFALSFDEEVGCAGAPLL 160 ********************************************************************** PP TIGR01892 142 ieala...rrpalaivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlvalad 208 i+ l+ +p+ ivGePts++++ ahkG+ + + vrG+ +hss + +G++aie aa+l+ + ++ad lcl|FitnessBrowser__BFirm:BPHYT_RS09285 161 IADLMkrgVKPDGCIVGEPTSMRPIVAHKGINAYQCCVRGQAAHSSLTPKGLNAIEYAARLICYIRDMAD 230 **99977789************************************************************ PP TIGR01892 209 klkr.edleeaFtppyatlniGtvkGGkavniiaaaCelvlelRpipGmdpeellallekiaee.....v 272 + ++ ++++e +++p++t + t+ GG+a n ++a+C++++e+R +p +dpe + a + + a e + lcl|FitnessBrowser__BFirm:BPHYT_RS09285 231 QFREqGPFDELYDVPFTTAQTSTIVGGNAINTVPAECKFQFEFRNLPTLDPEPIFARIDQYAREtllpkM 300 **99799***************************************************999998888888 PP TIGR01892 273 kekapgfevkveelsatpaleleedaelvalleklaGa.aaevvsygteagllqelGieavvlGPGdidq 341 +++p +++ + a p+l+ e+a + +l++ l+ + + v+ygteagl+ +Gi+++v+GPGdi+q lcl|FitnessBrowser__BFirm:BPHYT_RS09285 301 LREHPSAAIEITKIAAAPGLDSSEQAAITQLVRALTADqDKRKVAYGTEAGLFSLAGIPSIVCGPGDIQQ 370 899**********************************98999**************************** PP TIGR01892 342 ahqpdeYveieelkrcrallerl 364 ah+p+e+v +++l++c+ +l++ lcl|FitnessBrowser__BFirm:BPHYT_RS09285 371 AHKPNEFVALDQLVACERFLQKF 393 *******************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (404 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.52 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory