GapMind for Amino acid biosynthesis

 

Alignments for a candidate for argE in Burkholderia phytofirmans PsJN

Align Acetylornithine deacetylase; AO; Acetylornithinase; EC 3.5.1.16; N-acetylornithinase; NAO (uncharacterized)
to candidate BPHYT_RS11720 BPHYT_RS11720 acetylornithine deacetylase

Query= curated2:O68873
         (380 letters)



>FitnessBrowser__BFirm:BPHYT_RS11720
          Length = 387

 Score =  212 bits (540), Expect = 1e-59
 Identities = 147/384 (38%), Positives = 197/384 (51%), Gaps = 33/384 (8%)

Query: 9   RATLTELVAMDTTSFRPNVPLIDYAQARLEAAGFSAERQKFLDDAGVEKVNLVAVKGGSG 68
           RA L  L+   T S   N+ +ID+ +  L   G  +E      +A   K NL A  G   
Sbjct: 7   RALLERLIGFATVSRDSNLEMIDFIRGYLGELGVESE---LFYNAERSKANLFATIGPRE 63

Query: 69  SGRAALALVGHSDCVPYDA-AWT-DALRLTEKDGRLYARGACDTKGFIACALHAA--LNA 124
            G   + L GH+D VP +  AWT DA RLTE+DGRLY RGA D KG+IA  L A   L  
Sbjct: 64  GG--GIVLSGHTDVVPVEGQAWTVDAFRLTERDGRLYGRGAADMKGYIASVLAAVPGLRE 121

Query: 125 EQLKAPLMVVLTADEEVGLTGAKKLVEAGLGRARH----AIVGEPTRLIPVRANKGYCLA 180
            +LK P+ +  + DEEVG  G + ++ A L +  H     ++GEPT L PV  +KG    
Sbjct: 122 RELKLPVHLAFSYDEEVGCLGVRPML-AELAQRAHKPALCLIGEPTELKPVLGHKGKLAM 180

Query: 181 EVEVRGKEGHSAYPDSGASAIFRAGRFLQRLEHLALTVLR-EDLDEGFQPPFTTVNVGVI 239
             +V+G   HSAY   G +AI  A R + RLE +   + R E  D  F PPF+TV  GVI
Sbjct: 181 RCQVKGAPCHSAYAPYGVNAIQYAARMIGRLEEIGELLARPEHHDARFDPPFSTVQTGVI 240

Query: 240 QGGKAKNVIPGACRFVVEWRPIPGQPPERVSQLLETIRQELVRDEPAFEAQIRVVRTDR- 298
            GG+A N++P  C F  E R +PG    RV+  L+      +  E     ++R V++D  
Sbjct: 241 NGGRALNIVPAECEFDFEVRALPGFDANRVADELQ------IYAEAELLPKMRAVKSDTD 294

Query: 299 ----------GVNTRADAEVVRFLAEASGNAP-ETVSFGTEAPQMTELGAEAVVFGPGDI 347
                     G+ T  D+E  R LA  SG+    TV+FGTE     E G   VV GPG +
Sbjct: 295 IRFQSLSAYPGLATSPDSEAARLLALLSGSTEYGTVAFGTEGGLFDEAGIPTVVCGPGSM 354

Query: 348 RVAHQTGEYVPVEDLVRCEAVLAR 371
              H+  E+V V  L  C+A+LAR
Sbjct: 355 DQGHKPDEFVTVAQLRECDAMLAR 378


Lambda     K      H
   0.319    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 363
Number of extensions: 15
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 380
Length of database: 387
Length adjustment: 30
Effective length of query: 350
Effective length of database: 357
Effective search space:   124950
Effective search space used:   124950
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)

Align candidate BPHYT_RS11720 BPHYT_RS11720 (acetylornithine deacetylase)
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))

Software error:

../bin/blast/fastacmd -i /tmp/list.21219.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.21219.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.

For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.