Align Carbamoyl-phosphate synthase arginine-specific small chain; CPS-A; Arginine-specific carbamoyl-phosphate synthetase, glutamine chain; EC 6.3.5.5 (characterized)
to candidate 350084 BT0556 carbamoyl phosphate synthetase III (glutamine-hydrolyzing) (NCBI ptt file)
Query= SwissProt::P07258 (411 letters) >FitnessBrowser__Btheta:350084 Length = 388 Score = 343 bits (879), Expect = 7e-99 Identities = 182/388 (46%), Positives = 236/388 (60%), Gaps = 39/388 (10%) Query: 9 TFCIQNGPSFEGISFGANKSVAGETVFTTSLVGYPESMTDPSYRGQILVFTQPLIGNYGV 68 T + +G F G SFG K VAGE VF T++ GYPES+TDPSY GQ++ T PL+GNYGV Sbjct: 5 TLILDDGSRFSGKSFGYEKPVAGEVVFNTAMTGYPESLTDPSYAGQLMTLTYPLVGNYGV 64 Query: 69 PSGEARDEYNLLKYFESPHIHVVGIVVAEYAYQYSHWTAVESLAQWCQREGVAAITGVDT 128 P + L + ES IH I+V++Y+ +YSHW AVESL W +RE V ITG+DT Sbjct: 65 PPFTI-EPNGLATFMESEKIHAEAIIVSDYSSEYSHWNAVESLGDWLKREKVPGITGIDT 123 Query: 129 RELVQYLREQGSSLGRITL-------ADHDPVPYVNPMKTNLVAQVTTKKPFHVSALP-- 179 REL + LRE G +GRI D+ + N N V +V+ K+ +S LP Sbjct: 124 RELTKILREHGVMMGRIVFDDEIVGEIDNGQLTMDNYAAVNYVDRVSCKE--IISYLPDG 181 Query: 180 ---------------------GKAKANVALIDCGVKENIIRCLVKRGANVTVFPYDYRIQ 218 V L+DCGVK NIIRCL++RG V P+DY Sbjct: 182 TSQCFPLSTSIAQLNSQLLTFNSQLKKVVLVDCGVKTNIIRCLLRRGVEVIRVPWDYDFN 241 Query: 219 DVASEFDGIFLSNGPGNPELCQATISNVRELLNNPVYDCIPIFGICLGHQLLALASGAST 278 + EFDG+F+SNGPG+P+ C A + N+R+ + N + +PIFGIC+G+QLL+ A GA Sbjct: 242 GL--EFDGLFISNGPGDPDTCDAAVQNIRKAMAN---EKLPIFGICMGNQLLSKAGGAKI 296 Query: 279 HKLKYGNRAHNIPAMDLTTGQCHITSQNHGYAVDPETLPKDQWKPYFVNLNDKSNEGMIH 338 +KLKYG+R+HN P + T +C ITSQNHGYAVD TL D W+P F+N+ND SNEG+ H Sbjct: 297 YKLKYGHRSHNQPVRMVGTERCFITSQNHGYAVDNNTLGAD-WEPLFINMNDGSNEGIKH 355 Query: 339 LQRPIFSTQFHPEAKGGPLDTAILFDKF 366 + P FS QFHPEA GP DT LFD+F Sbjct: 356 KKNPWFSAQFHPEAASGPTDTEFLFDEF 383 Lambda K H 0.318 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 458 Number of extensions: 20 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 411 Length of database: 388 Length adjustment: 31 Effective length of query: 380 Effective length of database: 357 Effective search space: 135660 Effective search space used: 135660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 350084 BT0556 (carbamoyl phosphate synthetase III (glutamine-hydrolyzing) (NCBI ptt file))
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.7648.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5.2e-139 449.1 0.0 5.9e-139 449.0 0.0 1.0 1 lcl|FitnessBrowser__Btheta:350084 BT0556 carbamoyl phosphate synth Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:350084 BT0556 carbamoyl phosphate synthetase III (glutamine-hydrolyzing) (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 449.0 0.0 5.9e-139 5.9e-139 2 359 .. 5 387 .. 4 388 .] 0.92 Alignments for each domain: == domain 1 score: 449.0 bits; conditional E-value: 5.9e-139 TIGR01368 2 tlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneeda.........es 68 tl+l+dG+ f+gksfg+ek v+GevvFnT+mtGY+E+ltDpsY+gq+++ltypl+gnygv++ ++ es lcl|FitnessBrowser__Btheta:350084 5 TLILDDGSRFSGKSFGYEKPVAGEVVFNTAMTGYPESLTDPSYAGQLMTLTYPLVGNYGVPPFTIepnglatfmES 80 79************************************************************999999******** PP TIGR01368 69 kkikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavisteksekeelvekake 144 +ki++++++v+++s+e+s+++a esL ++lk+e++++i+g+DTR+l+k lRe+g+m+++i+ +++ e + + lcl|FitnessBrowser__Btheta:350084 81 EKIHAEAIIVSDYSSEYSHWNAVESLGDWLKREKVPGITGIDTRELTKILREHGVMMGRIVFDDEIVGEIDNGQLT 156 *************************************************************999776555555555 PP TIGR01368 145 spkvkevnlvkevstkeayeleq..............k.....akkegkklrvvvidlGvKenilreLvkrgvevt 201 + + vn+v++vs+ke +++ + + +++ ++vv++d+GvK+ni+r+L++rgvev+ lcl|FitnessBrowser__Btheta:350084 157 MDNYAAVNYVDRVSCKEIISYLPdgtsqcfplstsiaQlnsqlLTFNSQLKKVVLVDCGVKTNIIRCLLRRGVEVI 232 6666679************999878887777776665155555344444478************************ PP TIGR01368 202 vvpadtsaeeikklnpdgillsnGPGdPaaveeaietvkkllea.kiPifGIclGhqllalalgaktyklkfGhrG 276 vp+d++++ l+ dg+++snGPGdP+++++a+++++k++ + k+PifGIc+G+qll++a gak+yklk+Ghr lcl|FitnessBrowser__Btheta:350084 233 RVPWDYDFN---GLEFDGLFISNGPGDPDTCDAAVQNIRKAMANeKLPIFGICMGNQLLSKAGGAKIYKLKYGHRS 305 *******99...67779**********************9887669****************************** PP TIGR01368 277 aNhpvkdlktgrveitsqNHgyavdeeslkeeelevthvnlnDgtveglehkelpvfsvQyHPeaspGphdteylF 352 +N+pv+ + t+r++itsqNHgyavd+++l ++e+ + n+nDg++eg++hk+ p fs Q+HPea++Gp+dte+lF lcl|FitnessBrowser__Btheta:350084 306 HNQPVRMVGTERCFITSQNHGYAVDNNTLG-ADWEPLFINMNDGSNEGIKHKKNPWFSAQFHPEAASGPTDTEFLF 380 ***************************976.66******************************************* PP TIGR01368 353 defveli 359 defv+l+ lcl|FitnessBrowser__Btheta:350084 381 DEFVNLL 387 ****986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (388 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 7.47 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory