Align aspartate-ammonia ligase (EC 6.3.1.1) (characterized)
to candidate 351657 BT2129 aspartate--ammonia ligase (NCBI ptt file)
Query= BRENDA::Q57WT9 (351 letters) >FitnessBrowser__Btheta:351657 Length = 345 Score = 323 bits (827), Expect = 5e-93 Identities = 162/333 (48%), Positives = 221/333 (66%), Gaps = 20/333 (6%) Query: 16 ILTVKRSFSEALEKELNLVEVRAPILFRVGDGTQDNLSGFEKAVQVPVKAIPNASFEVVH 75 I +K F L EL L V AP+ G G D+L+G E+ V P+K + +A EVVH Sbjct: 23 IKQIKEFFQLNLSSELRLRRVTAPLFVLKGMGINDDLNGIERPVSFPIKDLGDAQAEVVH 82 Query: 76 SLAKWKRRTLANYKFAPGHGLYTHMTALRVDDVLDNIHSVVVDQWDWEMVMKDDQRNLAF 135 SLAKWKR TLA+Y PG+G+YT M A+R D+ L N+HS+ VDQWDWE V+ ++ RN+ F Sbjct: 83 SLAKWKRLTLADYNIEPGYGIYTDMNAIRSDEELGNLHSLYVDQWDWERVITNEDRNVEF 142 Query: 136 LKEVVCKVYAAIRKTELAVCEKYKQ-KPILPETIQFVHAEHLLLAYPNLTAKEREREIAR 194 LKE+V ++YAA+ +TE V E Y Q KP LP+ + F+H+E L YPNL K RE I + Sbjct: 143 LKEIVNRIYAAMIRTEYMVYEMYPQIKPCLPQKLHFIHSEELRQLYPNLEPKCREHAICQ 202 Query: 195 EYGAVFLIGIGAVLSSGDRHDARAPDYDDWTSPVEASQVVFPRTSKPIPTMNSLSSLKGL 254 +YGAVF+IGIG LS G +HD RAPDYDD+TS L++L GL Sbjct: 203 KYGAVFIIGIGCKLSDGKKHDGRAPDYDDYTS-------------------TGLNNLPGL 243 Query: 255 NGDILLYNPTLDDSLEVSSMGIRVNAEALRHQISLTGDDSLLKSEWHQQLLNGEFPQTVG 314 NGD+LL++ L S+E+SSMG+RV+ EAL+ Q+ ++ LK +H++L++ P ++G Sbjct: 244 NGDLLLWDDVLQRSIELSSMGVRVDREALQRQLKEENEEERLKLYFHKRLMDDTLPLSIG 303 Query: 315 GGIGQSRMVMFMLRKKHIGEVQCSVWPEEIRKK 347 GGIGQSR+ MF LRK HIGE+Q S+WPE++RK+ Sbjct: 304 GGIGQSRLCMFYLRKAHIGEIQASIWPEDMRKE 336 Lambda K H 0.319 0.135 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 351 Length of database: 345 Length adjustment: 29 Effective length of query: 322 Effective length of database: 316 Effective search space: 101752 Effective search space used: 101752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate 351657 BT2129 (aspartate--ammonia ligase (NCBI ptt file))
to HMM TIGR00669 (asnA: aspartate--ammonia ligase (EC 6.3.1.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00669.hmm # target sequence database: /tmp/gapView.27572.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00669 [M=330] Accession: TIGR00669 Description: asnA: aspartate--ammonia ligase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1e-120 389.0 0.0 1.2e-120 388.7 0.0 1.0 1 lcl|FitnessBrowser__Btheta:351657 BT2129 aspartate--ammonia ligase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:351657 BT2129 aspartate--ammonia ligase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 388.7 0.0 1.2e-120 1.2e-120 11 328 .. 22 339 .. 13 341 .. 0.97 Alignments for each domain: == domain 1 score: 388.7 bits; conditional E-value: 1.2e-120 TIGR00669 11 eisfvkstftqklierlglievqgpilsqvgdgiqdnlsgiekavqvkvkaipdaafevvhslakwkrhtlarydf 86 +i +k+ f +l +l l v +p++ g gi+d+l gie+ v+ +k + da+ evvhslakwkr tla y++ lcl|FitnessBrowser__Btheta:351657 22 GIKQIKEFFQLNLSSELRLRRVTAPLFVLKGMGINDDLNGIERPVSFPIKDLGDAQAEVVHSLAKWKRLTLADYNI 97 47789*********************************************************************** PP TIGR00669 87 kedeglfvhmkalrpdedsldpvrsvyvdqwdwekvvpegernlaylketveaiyaairatevavserf.glaall 161 + + g+++ m a+r de+ l +++s+yvdqwdwe+v+++ +rn+ +lke v++iyaa+ te +v e + ++++ l lcl|FitnessBrowser__Btheta:351657 98 EPGYGIYTDMNAIRSDEE-LGNLHSLYVDQWDWERVITNEDRNVEFLKEIVNRIYAAMIRTEYMVYEMYpQIKPCL 172 ****************96.899*******************************************9998679**** PP TIGR00669 162 pkqivfvhseelvkrypdldskgredaiakelgavfligiggklsdgkphdvrapdyddwtteselgykglngdil 237 p++++f+hseel + yp+l+ k re+ai++++gavf+igig klsdgk+hd+rapdydd+t+ ++ glngd+l lcl|FitnessBrowser__Btheta:351657 173 PQKLHFIHSEELRQLYPNLEPKCREHAICQKYGAVFIIGIGCKLSDGKKHDGRAPDYDDYTSTGLNNLPGLNGDLL 248 **************************************************************************** PP TIGR00669 238 vwnpvlgkafelssmgirvdedalrlqlaltgdedrlelewhqdllngklpqtigggigqsrlamlllqkkhigev 313 +w++vl++++elssmg+rvd +al++ql +e+rl+l +h+ l++ lp++igggigqsrl+m+ l+k hige+ lcl|FitnessBrowser__Btheta:351657 249 LWDDVLQRSIELSSMGVRVDREALQRQLKEENEEERLKLYFHKRLMDDTLPLSIGGGIGQSRLCMFYLRKAHIGEI 324 **************************************************************************** PP TIGR00669 314 qasvwpkevreeven 328 qas+wp+++r+e e+ lcl|FitnessBrowser__Btheta:351657 325 QASIWPEDMRKECEE 339 **********99886 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (330 nodes) Target sequences: 1 (345 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 11.96 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory