Align 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 (uncharacterized)
to candidate 353501 BT3975 3-dehydroquinate synthase (NCBI ptt file)
Query= curated2:A6LEZ7 (353 letters) >FitnessBrowser__Btheta:353501 Length = 353 Score = 407 bits (1046), Expect = e-118 Identities = 196/353 (55%), Positives = 261/353 (73%) Query: 1 MSEQKVVICKDLKSELQDFLSSLKYDKLFILMDTNTKEKCFPLVEDIPAFQKAPILVMEA 60 MS+Q+V++C+ L++ L + +DKLFIL D +T+ C P ++++ + A + + A Sbjct: 1 MSKQEVILCESLETSLGRAIERCPHDKLFILTDEHTQRLCLPSLKEVSFLKDAVEICIGA 60 Query: 61 GDMNKGFVSLAQIWTALSNEGASRNSLLVNLGGGMITDMGGFAGATFKRGIRTINIPTTL 120 D++K +LA +W ALS +GA+R+SLL+NLGGGM+TD+GGFA ATFKRGI INIPTTL Sbjct: 61 EDVHKTLETLASVWMALSQQGATRHSLLINLGGGMVTDLGGFAAATFKRGISYINIPTTL 120 Query: 121 MASVDAAVGGKTGINFNGLKNEVGSFYPPLCVFIDCDFLRTLDRDNILSGYAEMIKHGLI 180 +A VDA+VGGKTGINFNGLKNE+GSF P V I+ +FLR+LD N SGYAEM+KHGLI Sbjct: 121 LAMVDASVGGKTGINFNGLKNEIGSFAPADSVLIETEFLRSLDAQNFFSGYAEMLKHGLI 180 Query: 181 SSMENYASVMLFDIDTMNYSYLNSLVGQSVAVKERIVEEDPKEQGIRKALNFGHTIGHAF 240 S+ ++ ++ F+ + ++Y+YL ++VG+SV VKE IVE+DP E GIRKALN GHT GHAF Sbjct: 181 SNTAHWVELLDFNTNNIDYAYLKNMVGRSVQVKEDIVEQDPFEHGIRKALNLGHTAGHAF 240 Query: 241 ESLSFLKMRPILHGHAVAAGIVSELYLSHKLCGFPMEKLSQVVYYIKEYYPALFFDCTDY 300 ESL+ + RP+LHG+AVA GIV ELYLSH GFP +K+ Q + +IKE Y + FDC Y Sbjct: 241 ESLALAENRPVLHGYAVAWGIVCELYLSHLKVGFPKDKMRQTIQFIKENYGSFAFDCKQY 300 Query: 301 DTLYELMTHDKKNEGGIINFTLLKNVGDVRINQSVTKEKILESLDFYRESFGI 353 + LY M HDKKN G +NFTLLK +GD+ INQ+ K+ I E LDFYRE G+ Sbjct: 301 EQLYAFMQHDKKNTSGTVNFTLLKEIGDICINQTADKDTIFEMLDFYRECMGV 353 Lambda K H 0.321 0.139 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 353 Length adjustment: 29 Effective length of query: 324 Effective length of database: 324 Effective search space: 104976 Effective search space used: 104976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 353501 BT3975 (3-dehydroquinate synthase (NCBI ptt file))
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.3384.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.8e-102 329.0 0.0 2e-102 328.9 0.0 1.0 1 lcl|FitnessBrowser__Btheta:353501 BT3975 3-dehydroquinate synthase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:353501 BT3975 3-dehydroquinate synthase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 328.9 0.0 2e-102 2e-102 5 341 .. 8 342 .. 4 345 .. 0.93 Alignments for each domain: == domain 1 score: 328.9 bits; conditional E-value: 2e-102 TIGR01357 5 vgegllkklveelae.kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletvaklldqlleek 79 + e+l ++l +++++ ++kl+++tde++++l+ l+e+ + ++ + + + +K+let+a+++ +l +++ lcl|FitnessBrowser__Btheta:353501 8 LCESLETSLGRAIERcPHDKLFILTDEHTQRLCLPSLKEVSF--LKDAVEICIGAEDVHKTLETLASVWMALSQQG 81 5555556788888887779*******************9994..6899999************************* PP TIGR01357 80 lerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgkNliGafyqPkaVlidlk 155 ++r+s+l+++GGG v+Dl+GF+Aat++RGi+++++PTtllamvD+svGGKtgin+++ kN iG+f + Vli+++ lcl|FitnessBrowser__Btheta:353501 82 ATRHSLLINLGGGMVTDLGGFAAATFKRGISYINIPTTLLAMVDASVGGKTGINFNGLKNEIGSFAPADSVLIETE 157 **************************************************************************** PP TIGR01357 156 vletlperelreGmaEviKhgliadaelfeelekneklllklaelealeelikrsievKaevVeeDekesglRalL 231 +l++l+ +++ +G+aE++Khgli++ + + el +++ ++ + + l++++ rs++vK+++Ve+D+ e+g+R++L lcl|FitnessBrowser__Btheta:353501 158 FLRSLDAQNFFSGYAEMLKHGLISNTAHWVELLDFNT--NN-IDYAYLKNMVGRSVQVKEDIVEQDPFEHGIRKAL 230 ********************************99987..43.4679****************************** PP TIGR01357 232 NfGHtlgHaiEallkyk...lsHGeaVaiGmvveaklseklgllkaellerlvallkklglptklkkklsveellk 304 N+GHt gHa E+l+ + + HG aVa+G+v+e++ls+ + +++++++++++++k+ + + + + ++e+l++ lcl|FitnessBrowser__Btheta:353501 231 NLGHTAGHAFESLALAEnrpVLHGYAVAWGIVCELYLSHLKVGFPKDKMRQTIQFIKENYGSFAFD-CKQYEQLYA 305 ***********987666679***********************************99987666666.7******** PP TIGR01357 305 allkDKKnegskiklvlleeiGkaalasevteeelle 341 ++++DKKn ++++++ ll+eiG++ ++++ +++++ e lcl|FitnessBrowser__Btheta:353501 306 FMQHDKKNTSGTVNFTLLKEIGDICINQTADKDTIFE 342 **************************98777776655 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (353 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.53 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory