Align Fructose-bisphosphate aldolase; Glfba; glFBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 (characterized)
to candidate 351219 BT1691 fructose-bisphosphate aldolase (NCBI ptt file)
Query= SwissProt::A8B2U2 (323 letters) >FitnessBrowser__Btheta:351219 Length = 334 Score = 280 bits (715), Expect = 5e-80 Identities = 152/316 (48%), Positives = 203/316 (64%), Gaps = 22/316 (6%) Query: 3 LCTLRQMLGEARKHKYGVGAFNVNNMEQIQGIMKAVVQLKSPVILQCSRGALKYSDMIYL 62 L R M +A K Y + AFN NNMEQ+Q I+KA V+ KSPVILQ S+GA +Y++ L Sbjct: 9 LVNTRDMFAKAIKGGYAIPAFNFNNMEQMQAIIKAAVETKSPVILQVSKGARQYANATLL 68 Query: 63 KKLCEAALE-------KHPDIPICIHLDHGDTLESVKMAIDLGFSSVMIDASHHPFDENV 115 + + + A+E HP+I +HLDHGDT E+ K ID GFSSVMID SH P++ENV Sbjct: 69 RYMAQGAVEYAKELGCAHPEI--VLHLDHGDTFETCKSCIDSGFSSVMIDGSHLPYEENV 126 Query: 116 RITKEVVAYAHARGVSVEAELGTLGGIEEDVQNTVQL-TEPQDAKKFVELTGVDALAVAI 174 +TK+VV YAH V+VE ELG L G+E++V + T+P++ F TG D+LA++I Sbjct: 127 ALTKKVVEYAHQFDVTVEGELGVLAGVEDEVSSDHHTYTDPEEVIDFATRTGCDSLAISI 186 Query: 175 GTSHGAYKFKSES-----------DIRLAIDRVKTISD-LTGIPLVMHGSSSVPKDVKDM 222 GTSHGAYKF E LA + + + + L G P+V+HGSSSVP++ + Sbjct: 187 GTSHGAYKFTPEQCHIDPATGRMVPPPLAFEVLDAVMEKLPGFPIVLHGSSSVPEEEVET 246 Query: 223 INKYGGKMPDAVGVPIESIVHAIGEGVCKINVDSDSRMAMTGAIRKVFVEHPEKFDPRDY 282 INK+GG + A+G+P E + A VCKIN+DSDSR+AMT AIRK F E P +FDPR Y Sbjct: 247 INKFGGALKAAIGIPEEELRKAAKSAVCKINIDSDSRLAMTAAIRKTFAEKPAEFDPRKY 306 Query: 283 LGPGRDAITEMLIPKI 298 LGP RD + ++ KI Sbjct: 307 LGPARDNMEKLYKHKI 322 Lambda K H 0.318 0.135 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 318 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 334 Length adjustment: 28 Effective length of query: 295 Effective length of database: 306 Effective search space: 90270 Effective search space used: 90270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate 351219 BT1691 (fructose-bisphosphate aldolase (NCBI ptt file))
to HMM TIGR01859 (fba: fructose-1,6-bisphosphate aldolase, class II (EC 4.1.2.13))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01859.hmm # target sequence database: /tmp/gapView.12119.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01859 [M=282] Accession: TIGR01859 Description: fruc_bis_ald_: fructose-1,6-bisphosphate aldolase, class II Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-112 359.6 0.0 1.2e-111 358.9 0.0 1.3 1 lcl|FitnessBrowser__Btheta:351219 BT1691 fructose-bisphosphate ald Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:351219 BT1691 fructose-bisphosphate aldolase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 358.9 0.0 1.2e-111 1.2e-111 1 281 [. 9 331 .. 9 332 .. 0.96 Alignments for each domain: == domain 1 score: 358.9 bits; conditional E-value: 1.2e-111 TIGR01859 1 lvkakellekakkekYavgafninnlellqaileaaeeeksPvivqvsegavkYlg...gikvvvalvkaliekls 73 lv+++++++ka k++Ya++afn+nn+e++qai++aa e+ksPvi+qvs+ga++Y++ ++ +++++v+++ e lcl|FitnessBrowser__Btheta:351219 9 LVNTRDMFAKAIKGGYAIPAFNFNNMEQMQAIIKAAVETKSPVILQVSKGARQYANatlLRYMAQGAVEYAKELGC 84 79******************************************************87777899999999999888 PP TIGR01859 74 ivP.valhLDhGssyescikaikaGfssvmiDashlpleenlketkkvveiahakgvsveaelGklgGieddvvek 148 P ++lhLDhG+++e+c ++i++GfssvmiD+shlp+een+++tkkvve+ah+ v+ve elG+l+G+ed+v ++ lcl|FitnessBrowser__Btheta:351219 85 AHPeIVLHLDHGDTFETCKSCIDSGFSSVMIDGSHLPYEENVALTKKVVEYAHQFDVTVEGELGVLAGVEDEVSSD 160 8555************************************************************************ PP TIGR01859 149 eaeladideakklvketgvDaLaiaiGtshG..kykge.............pkldferlkeikklln.lPlvlhGa 208 + +++d++e+ +++ +tg D+Lai+iGtshG k++ e p l fe l+++ ++l+ +P+vlhG+ lcl|FitnessBrowser__Btheta:351219 161 HHTYTDPEEVIDFATRTGCDSLAISIGTSHGayKFTPEqchidpatgrmvpPPLAFEVLDAVMEKLPgFPIVLHGS 236 *******************************5555566****************************99******** PP TIGR01859 209 s.....................GipeeqlkkaiklgiakvnidtdlrlaftaairkvleekkdeydpRkilapare 263 s Gipee+l+ka+k++++k+nid+d rla+taairk+++ek e+dpRk+l+par+ lcl|FitnessBrowser__Btheta:351219 237 SsvpeeevetinkfggalkaaiGIPEEELRKAAKSAVCKINIDSDSRLAMTAAIRKTFAEKPAEFDPRKYLGPARD 312 **************************************************************************** PP TIGR01859 264 alkevvkekik.vlgsagk 281 ++++++k+ki vlgs +k lcl|FitnessBrowser__Btheta:351219 313 NMEKLYKHKILnVLGSDNK 331 *********9669***998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (282 nodes) Target sequences: 1 (334 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.03u 0.00s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 3.52 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory