Align serine O-acetyltransferase (EC 2.3.1.30) (characterized)
to candidate 350000 BT0472 putative acyltransferase in colanic acid biosynthesis (NCBI ptt file)
Query= BRENDA::Q6F4D7 (295 letters) >FitnessBrowser__Btheta:350000 Length = 252 Score = 57.0 bits (136), Expect = 4e-13 Identities = 45/137 (32%), Positives = 66/137 (48%), Gaps = 6/137 (4%) Query: 114 IRRALAPFIFK-RVGKNPKFFQNVEFSVGYNLELGDDVVVHRYVFLDDI-GGIKIGDRTS 171 IR +IF ++ KN + E + L +G VV LD GGI IG+ + Sbjct: 95 IRDFFYKYIFLVKMEKNSVLYYGSEIRAPWMLMIGKGSVVGDNSILDARRGGIYIGENVN 154 Query: 172 LSDYVNVYSHTHHV----LASPDVTLKETIIGSGVRITYHATVLAGVRIGDDAMVGTGAV 227 ++ V++++ H S I + V I + T+L V IG+ A++ GAV Sbjct: 155 IASNVSLWTGGHDYNDPYFRSMKTNRGPIYIKNRVWIGPNVTILHSVTIGEGAVIAAGAV 214 Query: 228 VTKDIPPHAIALGIPAR 244 VTKDIPP I GIPA+ Sbjct: 215 VTKDIPPFTICGGIPAK 231 Lambda K H 0.321 0.142 0.437 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 200 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 252 Length adjustment: 25 Effective length of query: 270 Effective length of database: 227 Effective search space: 61290 Effective search space used: 61290 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory