Align Probable adenylyltransferase/sulfurtransferase MoeZ; EC 2.7.7.-; EC 2.8.1.- (characterized)
to candidate 350176 BT0648 molybdopterin biosynthesis protein (NCBI ptt file)
Query= SwissProt::P9WMN7 (392 letters) >FitnessBrowser__Btheta:350176 Length = 230 Score = 201 bits (511), Expect = 2e-56 Identities = 106/229 (46%), Positives = 144/229 (62%), Gaps = 18/229 (7%) Query: 22 RYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLYLAAAGVGTIGIVDFDVVDESN 81 RY R +++P++G DGQ++LK A+VL++G GGLG+P LYL AGVG IG+VD DVV SN Sbjct: 2 RYDRQMLLPEIGEDGQQKLKQAKVLIVGVGGLGSPIALYLTGAGVGCIGLVDDDVVSISN 61 Query: 82 LQRQVIHGVADVGRSKAQSARDSIVAINPLIRVRLHELRLAPSNAVDLFKQYDLILDGTD 141 LQRQV++ ++G+ KA A + + A+N I +R + RL NA ++ QYD+++DG D Sbjct: 62 LQRQVLYSEKELGKPKAICAAERLSALNSEITIRTYPTRLTEENAQEIISQYDIVVDGCD 121 Query: 142 NFATRYLVNDAAVLAGKPYVWGSIYRFEGQASVFWEDAPDGLGVNYRDLYPE-------P 194 NF+TRYL+ND GK YV+G+I FEGQ SVF +YRDLYP+ P Sbjct: 122 NFSTRYLINDICAEMGKVYVYGAICGFEGQVSVFHYGEEK---KSYRDLYPDEEEMRRMP 178 Query: 195 PPPGMVPSCAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLLVYD 243 PPP GV+GI A S+ TE +K+I G GE L G+L D Sbjct: 179 PPP--------KGVMGITPAVTGSIEATEVLKIICGFGEVLSGKLWTID 219 Lambda K H 0.319 0.137 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 271 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 392 Length of database: 230 Length adjustment: 27 Effective length of query: 365 Effective length of database: 203 Effective search space: 74095 Effective search space used: 74095 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory