Align alanine—glyoxylate transaminase (EC 2.6.1.44) (characterized)
to candidate 351943 BT2415 aspartate aminotransferase (NCBI ptt file)
Query= metacyc::MONOMER-21143 (387 letters) >FitnessBrowser__Btheta:351943 Length = 397 Score = 233 bits (593), Expect = 9e-66 Identities = 139/394 (35%), Positives = 212/394 (53%), Gaps = 12/394 (3%) Query: 2 KLAKNLQRLGTESAFSVLAEAKKLEAQGKPMIHLGLGQPDFKTPQHVVDAAKKALDEGHH 61 +L+ L L + ++ ++ +L+AQG +I+L +G+PDF TP H+ +AAKKA+D+ Sbjct: 3 QLSDRLNSLSPSATLAMSQKSNELKAQGIDVINLSVGEPDFNTPDHIKEAAKKAIDDNFS 62 Query: 62 GYVLSNGILECRQAVTRKIKKLYNKDIDPERVLIMPGGKPTMYYAIQCFGEPGAEIIHPT 121 Y G R A+ K+KK + ++ G K ++ AI PG E+I P Sbjct: 63 RYSPVPGYPALRNAIVEKLKKENGLEYTAAQISCANGAKQSVCNAILVLVNPGDEVIVPA 122 Query: 122 PAFPIYESMINYTGSTPVPYDLTEDKDLKFDPEKILSLITDKTRLLILINPNNPTGSFVE 181 P + Y M+ TPV ++D K P+++ + IT KT+ LIL +P+NPTGS Sbjct: 123 PYWVSYPEMVKMAEGTPVIVSAGIEQDFKITPKQLEAAITPKTKALILCSPSNPTGSVYS 182 Query: 182 KSAIDVLAEGLKKHPHVAILSDEIYSRQIYDGKEMPTFFNYPDLQDRLIVLDGWSKAYAM 241 K + LA L K+P V +++DEIY Y G + +P++++R ++++G SKAYAM Sbjct: 183 KEELAGLAAVLAKYPQVVVIADEIYEHINYIGAHQ-SIAQFPEMKERTVIVNGVSKAYAM 241 Query: 242 TGWRMGWSVWPEELIPHVNKLIINSVSCVNAPSQFAGIAALDGPDDAIHEMMVKFDQRRK 301 TGWR+G+ PE ++ NKL S + SQ A AA G + + EM F++RR Sbjct: 242 TGWRIGFIAGPEWIVKACNKLQGQYTSGPCSVSQKAAEAAYVGTQEPVKEMQKAFERRRD 301 Query: 302 LIHEGLNSLPGVECSLPGGAFYAFPK---VIGTG------MNGSEFAKKCMHEAGVAIVP 352 LI + +PG E ++P GAFY FPK G N + A + +A VA V Sbjct: 302 LIVKLAKEVPGFEVNVPQGAFYLFPKCSYFFGKSNGERKIENSDDLAMYLLEDAHVACVG 361 Query: 353 GTAFGKTCQDYVRFSYAASQDNISNALENIKKML 386 GT+FG + +R SYA S +NI A+ IK+ L Sbjct: 362 GTSFG--APECIRMSYATSDENIVEAIRRIKEAL 393 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 430 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 397 Length adjustment: 31 Effective length of query: 356 Effective length of database: 366 Effective search space: 130296 Effective search space used: 130296 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory