Align phosphoribosyl-ATP diphosphatase (EC 3.6.1.31) (characterized)
to candidate 353876 BT4350 conserved hypothetical protein (NCBI ptt file)
Query= metacyc::MONOMER-21148 (267 letters) >FitnessBrowser__Btheta:353876 Length = 262 Score = 174 bits (442), Expect = 1e-48 Identities = 95/254 (37%), Positives = 143/254 (56%), Gaps = 6/254 (2%) Query: 7 SLARLTDVIDRLLAPEGCPWDKEQTPESLCDYLVEECFELVEAIRSGNADEVREEMGDVM 66 + R D++D L CPWD++QT ESL +EE +EL +A+ + ++ +E+GDV+ Sbjct: 11 AFGRFLDILDELRVK--CPWDRKQTNESLRPNTIEETYELCDALMRDDKKDICKELGDVL 68 Query: 67 FLLAFLGRLYADKGAFTLDDAMANNAAKMIRRHPHVFSDTTYADRDEFLRNWESIKRAEK 126 +AF ++ ++ G F + D K+I RHPHVF + + NWE +K EK Sbjct: 69 LHVAFYAKIGSETGDFDIKDVCDKLCDKLIFRHPHVFGEVKAETAGQVSENWEQLKLKEK 128 Query: 127 ADAEGEPQGVYDSLPASLPPLLKAYRIHSKAARVGFTWPEDEDVERQVEAEWLELLDVLA 186 +G + V +P++LP L+KAYRI KA VGF W E E V +V+ E E +A Sbjct: 129 ---DGN-KSVLSGVPSALPSLIKAYRIQDKARNVGFDWEEREQVWDKVKEEIREFQVEVA 184 Query: 187 GDDKAAQENELGDLIFSLVELGRRKGIKANTALDMTNLKFLRRFRRMEALARERGLDFPA 246 DK E E GD++FSL+ R I + AL++TN KF+RRF +E + G + Sbjct: 185 NMDKEKAEAEFGDVMFSLINAARLYKINPDNALELTNQKFIRRFNYLEEHTIKEGKNLKD 244 Query: 247 LSLDDKDELWNEAK 260 +SL++ D +WNEAK Sbjct: 245 MSLEEMDAIWNEAK 258 Lambda K H 0.318 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 233 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 267 Length of database: 262 Length adjustment: 25 Effective length of query: 242 Effective length of database: 237 Effective search space: 57354 Effective search space used: 57354 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory