Align Ketol-acid reductoisomerase (NAD(+)); KARI; Acetohydroxy-acid isomeroreductase; AHIR; Alpha-keto-beta-hydroxylacyl reductoisomerase; EC 1.1.1.382 (characterized)
to candidate 351602 BT2074 ketol-acid reductoisomerase (NCBI ptt file)
Query= SwissProt::A8ZTR0 (352 letters) >FitnessBrowser__Btheta:351602 Length = 359 Score = 457 bits (1177), Expect = e-133 Identities = 225/347 (64%), Positives = 270/347 (77%), Gaps = 1/347 (0%) Query: 1 MPTINFGGVEENVVTSEEFTLKKAREVLKNEVITVLGYGVQGPAQALNLKDNGFEVIIGQ 60 M +NFGG ENVV +EF L+KAREVLKNE I V+GYGVQGP QALNL+DNGF VI+GQ Sbjct: 13 MAQLNFGGTVENVVIRDEFPLEKAREVLKNETIAVIGYGVQGPGQALNLRDNGFNVIVGQ 72 Query: 61 LEGDAYWEKAIADGFVPGKTLFPIEEAAKKGTIIKMLLSDAGQVAVWPKVKKCLKKGDAL 120 +G Y +KA+ADG+VPG+TLF IEEA +KGTII LLSDA ++VWP +K L G AL Sbjct: 73 RQGKTY-DKAVADGWVPGETLFGIEEACEKGTIIMCLLSDAAVMSVWPTIKPYLTAGKAL 131 Query: 121 YFSHGFGIVYKDQTGIVPPKNVDVILVAPKGSGTNVRRNFKDGSGINSSYAVFQDATGRA 180 YFSHGF I + D+TG+VPP ++DVI+VAPKGSGT++R F +G G+NSSYA++QDATG A Sbjct: 132 YFSHGFAITWSDRTGVVPPADIDVIMVAPKGSGTSLRTMFLEGRGLNSSYAIYQDATGNA 191 Query: 181 EERTIALGIAIGSGYLFPTTFEKEVFSDLTGERGVLMGCLAGTMEAQYNVLRKHGHSPSE 240 +RTIALGI IGSGYLF TTF +E SDLTGERG LMG + G + AQY VLR++GH+PSE Sbjct: 192 MDRTIALGIGIGSGYLFETTFIREATSDLTGERGSLMGAIQGLLLAQYEVLRENGHTPSE 251 Query: 241 AFNETVEELTQSLIRLVAENGMDWMFANCSTTAQRGALDWAPKFRDAVAPVFDSLYRRVK 300 AFNETVEELTQSL+ L A+NGMDWM+ANCSTTAQRGALDW F DA+ PV + LY VK Sbjct: 252 AFNETVEELTQSLMPLFAKNGMDWMYANCSTTAQRGALDWMGPFHDAIKPVVEKLYHSVK 311 Query: 301 NGAETRRVLKVNSAPNYLEKLRKELDTIKNSEMWQAGAAVRALRPEN 347 G E + + NS P+Y EKL +EL ++ SEMWQ VR LRPEN Sbjct: 312 TGNEAQISIDSNSKPDYREKLEEELKALRESEMWQTAVTVRKLRPEN 358 Lambda K H 0.316 0.134 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 443 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 352 Length of database: 359 Length adjustment: 29 Effective length of query: 323 Effective length of database: 330 Effective search space: 106590 Effective search space used: 106590 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
Align candidate 351602 BT2074 (ketol-acid reductoisomerase (NCBI ptt file))
to HMM TIGR00465 (ilvC: ketol-acid reductoisomerase (EC 1.1.1.86))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00465.hmm # target sequence database: /tmp/gapView.31246.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00465 [M=314] Accession: TIGR00465 Description: ilvC: ketol-acid reductoisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.7e-98 315.4 0.0 1.9e-98 315.2 0.0 1.0 1 lcl|FitnessBrowser__Btheta:351602 BT2074 ketol-acid reductoisomera Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Btheta:351602 BT2074 ketol-acid reductoisomerase (NCBI ptt file) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 315.2 0.0 1.9e-98 1.9e-98 1 313 [. 40 358 .. 40 359 .] 0.96 Alignments for each domain: == domain 1 score: 315.2 bits; conditional E-value: 1.9e-98 TIGR00465 1 lkgkkvaiiGyGsqGeaqalnlrdsglnvivglrkeaaswkkAeed....GfkvltveeaikkadlimiLlpDevq 72 lk++++a+iGyG qG +qalnlrd+g nvivg r++ ++++kA d G ++ +eea +k+ +im Ll+D++ lcl|FitnessBrowser__Btheta:351602 40 LKNETIAVIGYGVQGPGQALNLRDNGFNVIVGQRQG-KTYDKAVADgwvpGETLFGIEEACEKGTIIMCLLSDAAV 114 799*****************************9988.9********8888899*********************** PP TIGR00465 73 kevyeaeikpllkegkallfsHGfnivfkqiv...ipkdvdvvlvAPKgpGalvReeykegrGvpsliAveqdvtg 145 +v+ ikp+l++gkal+fsHGf i +++ + +p+d+dv++vAPKg+G+ +R ++ egrG++s++A++qd+tg lcl|FitnessBrowser__Btheta:351602 115 MSVWPT-IKPYLTAGKALYFSHGFAITWSDRTgvvPPADIDVIMVAPKGSGTSLRTMFLEGRGLNSSYAIYQDATG 189 ****99.*******************997654444***************************************** PP TIGR00465 146 eakeiAlayAkaiGgaragvlettFkeEvesDLfGEqavLcGglealikaafdtLveaGyqpelAyfeivhel.kl 220 +a++ a+ +iG++ +++ettF +E sDL GE++ L+G +++l++a++++L+e+G+ p++A++e+v+el ++ lcl|FitnessBrowser__Btheta:351602 190 NAMDRTIALGIGIGSG--YLFETTFIREATSDLTGERGSLMGAIQGLLLAQYEVLRENGHTPSEAFNETVEELtQS 263 *********9999999..*******************************************************9** PP TIGR00465 221 ivdllkekGlelmrdavsntAklgalelreilkeelkkemqkilkeiqnGefakewalekeagkpafeearkke.. 294 +++l ++G++ m+ ++s+tA++gal++ +++++k++++k+++++++G++a+ ++++ ++kp+++e+ + e lcl|FitnessBrowser__Btheta:351602 264 LMPLFAKNGMDWMYANCSTTAQRGALDWMGPFHDAIKPVVEKLYHSVKTGNEAQ-ISIDS-NSKPDYREKLEEElk 337 *****************************************************9.66665.9********999999 PP TIGR00465 295 ..keqeiekvGkelralvkae 313 +e e++++ +++r+l++++ lcl|FitnessBrowser__Btheta:351602 338 alRESEMWQTAVTVRKLRPEN 358 99**************99875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (314 nodes) Target sequences: 1 (359 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 8.15 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory