GapMind for Amino acid biosynthesis

 

Aligments for a candidate for leuB in Bacteroides thetaiotaomicron VPI-5482

Align 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (characterized)
to candidate 351385 BT1857 3-isopropylmalate dehydrogenase (NCBI ptt file)

Query= BRENDA::P54354
         (353 letters)



>lcl|FitnessBrowser__Btheta:351385 BT1857 3-isopropylmalate
           dehydrogenase (NCBI ptt file)
          Length = 353

 Score =  679 bits (1751), Expect = 0.0
 Identities = 335/353 (94%), Positives = 341/353 (96%)

Query: 1   MDFKIAVLAGDGIGPEISVQGVEVMSAVCEKFGHKVNYEYAICGADAIDKVGDPFPEETY 60
           MDFKIAVLAGDGIGPEISVQGV+VMSAVCEKFGHKV+YEYAICGADAIDKVGDPFPEETY
Sbjct: 1   MDFKIAVLAGDGIGPEISVQGVDVMSAVCEKFGHKVSYEYAICGADAIDKVGDPFPEETY 60

Query: 61  RVCKNADAVLFSAVGDPKFDNDPTAKVRPEQGLLAMRKKLGLFANIRPVQTFKCLVHKSP 120
            VCKNADAVLFSAVGDPKFDNDPTAKVRPEQGLLAMRKKLGLFANIRPVQTFKCL+HKSP
Sbjct: 61  EVCKNADAVLFSAVGDPKFDNDPTAKVRPEQGLLAMRKKLGLFANIRPVQTFKCLIHKSP 120

Query: 121 LRAELVEGADFLCIRELTGGMYFGEKYQDNDKAYDTNMYTRPEIERILKVGFEYAMKRRK 180
           LRAELVE ADF+CIRELTGGMYFGEKYQDNDKAYDTN YTRPEIERILKV FEYAMKRRK
Sbjct: 121 LRAELVENADFICIRELTGGMYFGEKYQDNDKAYDTNYYTRPEIERILKVAFEYAMKRRK 180

Query: 181 HLTVVDKANVLASSRLWRQIAQEMAPQYPEVTTDYMFVDNAAMKMIQEPKFFDVMVTENT 240
           HLTVVDKANVLASSRLWRQIAQEMAP YPEVTTDYMFVDNAAMKMIQEP FFDVMVTENT
Sbjct: 181 HLTVVDKANVLASSRLWRQIAQEMAPNYPEVTTDYMFVDNAAMKMIQEPAFFDVMVTENT 240

Query: 241 FGDILTDEGSVISGSMGLLPSASTGESTPVFEPIHGSWPQAKGLNIANPLAQILSVAMLF 300
           FGDILTDEGSVISGSMGLLPSASTGESTPVFEPIHGSWPQAKGLNIANPLAQILSVAMLF
Sbjct: 241 FGDILTDEGSVISGSMGLLPSASTGESTPVFEPIHGSWPQAKGLNIANPLAQILSVAMLF 300

Query: 301 EYFDCKAEGALIRKAVDASLDANVRTPEIQVEGGEKFGTKEVGAWIVDYIRKA 353
           EYFDCK EGALIRKAVDASLD NVRTPEIQV  G K+GTKEVG WIVDYI+KA
Sbjct: 301 EYFDCKEEGALIRKAVDASLDENVRTPEIQVADGAKYGTKEVGQWIVDYIKKA 353


Lambda     K      H
   0.319    0.136    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 626
Number of extensions: 20
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 353
Length of database: 353
Length adjustment: 29
Effective length of query: 324
Effective length of database: 324
Effective search space:   104976
Effective search space used:   104976
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)

Align candidate 351385 BT1857 (3-isopropylmalate dehydrogenase (NCBI ptt file))
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00169.hmm
# target sequence database:        /tmp/gapView.9541.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00169  [M=349]
Accession:   TIGR00169
Description: leuB: 3-isopropylmalate dehydrogenase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                          Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                          -----------
   1.7e-132  427.6   0.0   1.9e-132  427.5   0.0    1.0  1  lcl|FitnessBrowser__Btheta:351385  BT1857 3-isopropylmalate dehydro


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Btheta:351385  BT1857 3-isopropylmalate dehydrogenase (NCBI ptt file)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  427.5   0.0  1.9e-132  1.9e-132       1     347 [.       4     344 ..       4     346 .. 0.98

  Alignments for each domain:
  == domain 1  score: 427.5 bits;  conditional E-value: 1.9e-132
                          TIGR00169   1 kiavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadavLlgavGGpkW 76 
                                        kiavL+GDgiGpe+  + ++v+ av e+f++k+ +e+a  G  aid++g+P+peet + ck+adavL++avG pk+
  lcl|FitnessBrowser__Btheta:351385   4 KIAVLAGDGIGPEISVQGVDVMSAVCEKFGHKVSYEYAICGADAIDKVGDPFPEETYEVCKNADAVLFSAVGDPKF 79 
                                        79************************************************************************** PP

                          TIGR00169  77 dnlpr.dvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeivkgvDlvvvreLtgGiYfGepkereeaeee 151
                                        dn p+ +vrPe+gLL++rk+l+lfan+rP++ fk L++ spl++e+v++ D++++reLtgG+YfGe+ ++++    
  lcl|FitnessBrowser__Btheta:351385  80 DNDPTaKVRPEQGLLAMRKKLGLFANIRPVQTFKCLIHKSPLRAELVENADFICIRELTGGMYFGEKYQDND---- 151
                                        **986379**********************************************************999888.... PP

                          TIGR00169 152 kkaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlWrktveeiakeyPdvelehlyiDnaamqLv 227
                                         ka+dt  Yt++eieri +vafe a+krrk++t vDkanvL+ssrlWr++++e+a +yP+v+ + +++Dnaam+++
  lcl|FitnessBrowser__Btheta:351385 152 -KAYDTNYYTRPEIERILKVAFEYAMKRRKHLTVVDKANVLASSRLWRQIAQEMAPNYPEVTTDYMFVDNAAMKMI 226
                                        .8************************************************************************** PP

                          TIGR00169 228 ksPeqldvvvtsnlfGDilsDeasvitGslGlLPsaslsskglalfepvhgsapdiagkgianpiaailsaalllr 303
                                        ++P+ +dv+vt+n fGDil De svi+Gs+GlLPsas + + + +fep+hgs p+  g +ianp+a+ils+a+l +
  lcl|FitnessBrowser__Btheta:351385 227 QEPAFFDVMVTENTFGDILTDEGSVISGSMGLLPSASTG-ESTPVFEPIHGSWPQAKGLNIANPLAQILSVAMLFE 301
                                        **************************************9.8899******************************99 PP

                          TIGR00169 304 yslnleeaaeaieaavkkvleegkrtedlaseattavstkevee 347
                                        y ++ +e+ + i +av+  l+e  rt++++  ++++ +tkev++
  lcl|FitnessBrowser__Btheta:351385 302 Y-FDCKEEGALIRKAVDASLDENVRTPEIQVADGAKYGTKEVGQ 344
                                        8.89999999***********************9******9986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (349 nodes)
Target sequences:                          1  (353 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01
# Mc/sec: 7.03
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory